Animal-Free IL-17B Protein, Mouse (His)

IL-17B Proteinas, a key immune response regulator, stimulates THP-1 monocytic cells to release pro-inflammatory cytokines, TNF-α, and IL-1β. Its crucial role in orchestrating immune reactions and inflammatory pathways positions it as a potential modulator of immune homeostasis, making it a therapeutic intervention target for regulating inflammatory processes. Animal-Free IL-17B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17B protein, expressed by E. coli , with C-His, C-His labeled tag. The total length of Animal-Free IL-17B Protein, Mouse (His) is 160 a.a., with molecular weight of ~18.99 kDa.

IL-17B protein is a key regulator of immune responses, demonstrating its functional role in cellular signaling by specifically stimulating the release of pro-inflammatory cytokines, namely tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity underscores the protein's importance in orchestrating immune reactions and inflammatory pathways, positioning it as a potential modulator of immune homeostasis and a target for therapeutic interventions aimed at regulating inflammatory processes.

Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED₅₀ for this effect is <1.5 ng/mL.

Mouse

E. coli

C-His;C-His

Q9QXT6 (H21-F180)

56069  [NCBI]

MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

Approximately 18.99 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.