1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17B
  6. Animal-Free IL-17B Protein, Mouse (His)

Animal-Free IL-17B Protein, Mouse (His)

Cat. No.: HY-P78315AF
COA Handling Instructions

IL-17B Proteinas, a key immune response regulator, stimulates THP-1 monocytic cells to release pro-inflammatory cytokines, TNF-α, and IL-1β. Its crucial role in orchestrating immune reactions and inflammatory pathways positions it as a potential modulator of immune homeostasis, making it a therapeutic intervention target for regulating inflammatory processes. Animal-Free IL-17B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17B protein, expressed by E. coli , with C-His, C-His labeled tag. The total length of Animal-Free IL-17B Protein, Mouse (His) is 160 a.a., with molecular weight of ~18.99 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $60 In-stock
10 μg $168 In-stock
50 μg $470 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-17B Proteinas, a key immune response regulator, stimulates THP-1 monocytic cells to release pro-inflammatory cytokines, TNF-α, and IL-1β. Its crucial role in orchestrating immune reactions and inflammatory pathways positions it as a potential modulator of immune homeostasis, making it a therapeutic intervention target for regulating inflammatory processes. Animal-Free IL-17B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17B protein, expressed by E. coli , with C-His, C-His labeled tag. The total length of Animal-Free IL-17B Protein, Mouse (His) is 160 a.a., with molecular weight of ~18.99 kDa.

Background

IL-17B protein is a key regulator of immune responses, demonstrating its functional role in cellular signaling by specifically stimulating the release of pro-inflammatory cytokines, namely tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity underscores the protein's importance in orchestrating immune reactions and inflammatory pathways, positioning it as a potential modulator of immune homeostasis and a target for therapeutic interventions aimed at regulating inflammatory processes.

Biological Activity

Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-His;C-His

Accession

Q9QXT6 (H21-F180)

Gene ID

56069  [NCBI]

Molecular Construction
N-term
IL-17B (H21-F180)
Accession # Q9QXT6
His
C-term
Synonyms
IL-17B; Cytokine CX1; IL20; interleukin 17B; interleukin 20; MGC138900; MGC138901; NIRF; ZCYTO7
AA Sequence

MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

Molecular Weight

Approximately 18.99 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-17B Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-17B Protein, Mouse (His)
Cat. No.:
HY-P78315AF
Quantity:
MCE Japan Authorized Agent: