Copy Link Print Information

Animal-Free IL-17B Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

IL-17B Proteinas, a key immune response regulator, stimulates THP-1 monocytic cells to release pro-inflammatory cytokines, TNF-α, and IL-1β. Its crucial role in orchestrating immune reactions and inflammatory pathways positions it as a potential modulator of immune homeostasis, making it a therapeutic intervention target for regulating inflammatory processes. Animal-Free IL-17B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free IL-17B Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17B Proteinas, a key immune response regulator, stimulates THP-1 monocytic cells to release pro-inflammatory cytokines, TNF-α, and IL-1β. Its crucial role in orchestrating immune reactions and inflammatory pathways positions it as a potential modulator of immune homeostasis, making it a therapeutic intervention target for regulating inflammatory processes. Animal-Free IL-17B Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-17B protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-17B protein is a key regulator of immune responses, demonstrating its functional role in cellular signaling by specifically stimulating the release of pro-inflammatory cytokines, namely tumor necrosis factor alpha (TNF-α) and interleukin-1 beta (IL-1β), from the monocytic cell line THP-1. This activity underscores the protein's importance in orchestrating immune reactions and inflammatory pathways, positioning it as a potential modulator of immune homeostasis and a target for therapeutic interventions aimed at regulating inflammatory processes.

Verified Bioactivity

Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession

    Q9QXT6 (H21-F180)

  • Gene ID
    56069  [NCBI]
  • Molecular Construction
    • N-term
    • IL-17B (H21-F180)
      Accession # Q9QXT6
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17B; MGC138901; Interleukin 17B; Neuronal Interleukin-17 Related Factor; IL-17B; Cytokine-Like Protein ZCYTO7; ZCYTO7; Interleukin-17 Beta; IL-20; Cytokine Zcyto7; NIRF; Interleukin 20; Neuronal Interleukin-17-Related Factor; Interleukin-20; Interleukin

  • AA Sequence

    HPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHDPSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF

  • Predicted Molecular Mass

    19 kDa

  • Molecular Weight

    Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free IL-17B Protein, Mouse (His) Product Image
    1/16
  • Animal-Free IL-17B Protein, Mouse (His) Product Image