Animal-Free Intrinsic Factor/GIF Protein, Human (His)

Intrinsic factor (GIF) plays a crucial role in cobalamin (Cbl) absorption in the ileum. This well-coordinated process involves the interaction of the CBLIF-cobalamin complex with the Cubilin (CUBN) receptor, leading to internalization via receptor-mediated endocytosis. Animal-Free Intrinsic Factor/GIF Protein, Human (His) is the recombinant human-derived animal-FreeIntrinsic Factor/GIF protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Intrinsic Factor (GIF) stands as a key facilitator in the absorption of the essential vitamin cobalamin (Cbl) in the ileum. Its pivotal role unfolds through a well-orchestrated process, where the CBLIF-cobalamin complex, upon interaction with the Cubilin (CUBN) receptor, undergoes internalization via receptor-mediated endocytosis. This intricate interplay underscores the significance of GIF in ensuring the effective absorption of cobalamin, a crucial vitamin for various physiological processes. GIF's interaction with CUBN, particularly involving CUB domains, highlights the molecular intricacies governing this essential aspect of vitamin uptake.

Human

E. coli

C-6*His

P27352-1 (M1-Y417)

2694  [NCBI]

Full Length of Isoform-1

MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Approximately 46.23 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.