Animal-Free NAP-2/CXCL7 Protein, Mouse (His)

NAP-2/CXCL7 Protein, a member of the intercrine alpha family, is associated with chemokines regulating intercellular communication and immune responses. As part of this family, NAP-2/CXCL7 likely modulates inflammatory processes and cellular interactions. Further exploration is needed to reveal its specific functions and implications within the broader chemokine CxC family, highlighting its significance in mediating immune responses without relying on animal-derived sources. Animal-Free NAP-2/CXCL7 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeNAP-2/CXCL7 protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free NAP-2/CXCL7 Protein, Mouse (His) is 74 a.a., with molecular weight of ~8.93 kDa.

The NAP-2/CXCL7 protein is a member of the intercrine alpha (chemokine CxC) family. This classification highlights its affiliation with a group of chemokines involved in intercellular communication and immune responses. As part of the intercrine alpha family, NAP-2/CXCL7 likely plays a role in modulating inflammatory processes and cellular interactions. Further exploration is necessary to uncover the specific functions and implications of this protein within the broader context of the chemokine CxC family, shedding light on its significance in mediating immune responses without reliance on animal-derived sources.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <1 μg/mL.

Mouse

E. coli

N-His

Q9EQI5 (K40-Y113)

57349  [NCBI]

KSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY

Approximately 8.93 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.