2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Hydrolases (EC 3)
  5. Anionic trypsin-2 Protein, Rat (P.pastoris, His)

Anionic trypsin-2 Protein, Rat (P.pastoris, His)

Cat. No.: HY-P71774
Handling Instructions

Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P. pastoris , with N-His labeled tag. The total length of Anionic trypsin-2 Protein, Rat (P.pastoris, His) is 223 a.a., with molecular weight of ~25.3 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P. pastoris , with N-His labeled tag. The total length of Anionic trypsin-2 Protein, Rat (P.pastoris, His) is 223 a.a., with molecular weight of ~25.3 kDa.
Background

Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Anionic trypsin-2 is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. Anionic trypsin-2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion[1][2][3][4].
Species

Rat
Source

P. pastoris
Tag

N-His
Accession

P00763 (24I-246N)
Gene ID

25052  [NCBI]
Molecular Construction
N-term
His
Prss2 (24I-246N)
Accession # P00763
C-term
Synonyms
Prss2; Try2; Anionic trypsin-2; EC 3.4.21.4; Anionic trypsin II; Pretrypsinogen II; Serine protease 2
AA Sequence

IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

Molecular Weight

Approximately 25.3 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Anionic trypsin-2 Protein, Rat (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Anionic trypsin-2 Protein, Rat (P.pastoris, His)
Cat. No.:
HY-P71774
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.