Anionic trypsin-2 Protein, Rat (P.pastoris, His)
Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen.Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus.Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P.pastoris , with N-His labeled tag.
- Species: Rat
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen.Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus.Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P.pastoris , with N-His labeled tag.
Background
Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Anionic trypsin-2 is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. Anionic trypsin-2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion[1][2][3][4].
Technical Parameters
-
Species Rat
-
Source P. pastoris
-
Tag N-His
-
Accession
P00763 (I24-N246)
-
Molecular Construction
-
N-term
-
His
-
Prss2 (I24-N246)
Accession # P00763 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRSS2; Protease Serine 2 Preproprotein; Serine Protease 2; Protease, Serine, 2 (Trypsin 2); TRY2; Trypsinogen 2; Anionic Trypsinogen; PRSS2 Protein; Protease, Serine 2; Trypsinogen 8; Trypsin II; Trypsin 2; Trypsin-2; Trypsin; TRYP2; TRY8
-
AA Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
-
Predicted Molecular Mass
25.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
