Anionic trypsin-2 Protein, Rat (P.pastoris, His)

Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen.Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus.Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P.pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen.Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus.Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P.pastoris , with N-His labeled tag.

Background

Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen. Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. Anionic trypsin-2 is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. Anionic trypsin-2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion[1][2][3][4].

Technical Parameters

  • Species Rat
  • Source P. pastoris
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • Prss2 (I24-N246)
      Accession # P00763
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PRSS2; Protease Serine 2 Preproprotein; Serine Protease 2; Protease, Serine, 2 (Trypsin 2); TRY2; Trypsinogen 2; Anionic Trypsinogen; PRSS2 Protein; Protease, Serine 2; Trypsinogen 8; Trypsin II; Trypsin 2; Trypsin-2; Trypsin; TRYP2; TRY8

  • AA Sequence

    IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

  • Predicted Molecular Mass

    25.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00