Anionic trypsin Protein, Dog (His-SUMO)

Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. PRSS2 potentially participating in the degradation of type II collagen-rich cartilage matrix. Anionic trypsin Protein, Dog (His-SUMO) is the recombinant dog-derived Anionic trypsin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Anionic trypsin (serine protease 2, PRSS2) is a member of trypsin family of serine proteases which cleave peptide bonds that follow lysine or arginine residues. PRSS2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus. PRSS2 is found at high levels in pancreatic juice and its upregulation is a characteristic feature of pancreatitis. PRSS2 has also been found to activate pro-urokinase in ovarian tumors, suggesting a function in tumor invasion. In addition, PRSS2 is able to cleave across the type II collagen triple helix in rheumatoid arthritis synovitis tissue, potentially participating in the degradation of type II collagen-rich cartilage matrix^[1][2][3].

Dog

E. coli

N-His;N-SUMO

P06872 (I24-S247)

100686744  [NCBI]

Full Length of Mature Protein

IVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLNARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQITENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQSTIAANS

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.