APBA3 Protein, Human (His)
APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes[1].
APBA3 is a third member of the X11 protein family interacting with Alzheimer's â-amyloid precursor protein (APP). The gene spans about 11 kb and is composed of 10 coding exons and one untranslated exon. The APBA3 was localized by radiation hybrid mapping to chromosome 19. APBA3 contains PDZ (DHR) domains and 1 PID domain and interacts with the Alzheimer's disease amyloid precursor protein. APBA3 is widely expressed in many tissues and exhibiting lower levels in brain and testis[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O96018 (M1-L138)
-
Gene ID9546 [NCBI]
-
Molecular Construction
-
N-term
-
APBA3 (M1-L138)
Accession # O96018 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
APBA3; Mint-3; Amyloid Beta Precursor Protein Binding Family A Member 3; Amyloid Beta (A4) Precursor Protein-Binding, Family A, Member 3 (X11-Like 2); X11L2; Phosphotyrosine-Binding/-Interacting Domain (PTB)-Bearing Protein; Mint3; Amyloid Beta (A4) Precu
-
AA Sequence
MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRL
-
Predicted Molecular Mass
15.5 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. H Tanahashi, et al. Genomic organization of the human X11L2 gene (APBA3), a third member of the X11 protein family interacting with Alzheimer's beta-amyloid precursor protein. Neuroreport. 1999 Aug 20;10(12):2575-8. [Content Brief]
[2]. Toshiro Hara, et al. Deletion of the Mint3/Apba3 gene in mice abrogates macrophage functions and increases resistance to lipopolysaccharide-induced septic shock. J Biol Chem [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)