APBA3 Protein, Human (His)

APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

APBA3 Protein, Human (rHuAPBA3, His; Amyloid beta A4 precursor protein-binding family A member 3; APBA3) is an approximately 20.0 kDa APBA3 protein fused to His-tag. APBA3 Protein, Human (His) is an adapter protein that belongs to the X11 family and is involved in signal transduction processes[1].

Background

APBA3 is a third member of the X11 protein family interacting with Alzheimer's â-amyloid precursor protein (APP). The gene spans about 11 kb and is composed of 10 coding exons and one untranslated exon. The APBA3 was localized by radiation hybrid mapping to chromosome 19.
APBA3 contains PDZ (DHR) domains and 1 PID domain and interacts with the Alzheimer's disease amyloid precursor protein. APBA3 is widely expressed in many tissues and exhibiting lower levels in brain and testis[1].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • APBA3 (M1-L138)
      Accession # O96018
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    APBA3; Mint-3; Amyloid Beta Precursor Protein Binding Family A Member 3; Amyloid Beta (A4) Precursor Protein-Binding, Family A, Member 3 (X11-Like 2); X11L2; Phosphotyrosine-Binding/-Interacting Domain (PTB)-Bearing Protein; Mint3; Amyloid Beta (A4) Precu

  • AA Sequence

    MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRL

  • Predicted Molecular Mass

    15.5 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00