Apolipoprotein A-II/APOA2 Protein, Human (HEK293, His)

Apolipoprotein A-II/APOA2 Protein, Human (HEK293, His) is the recombinant human-derived Apolipoprotein A-II/APOA2 protein, expressed by HEK293, with C-His tag.

ApoA2 is a lipid-associated protein that may stabilize HDL (high density lipoprotein) structure and influence HDL metabolism.

Human

HEK293

C-His

P02652 (A19-Q100)

336

Full Length of Isoform-1 Mature Protein

ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Approximately 11 kDa & 13 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.