APT Protein, Streptococcus pyogenes serotype M1 (sf9, His-Myc)
APT, also known as adenine phosphoribosyltransferase, plays a crucial role in the rescue reaction that forms AMP (adenosine monophosphate). This salvage pathway provides a more energy-efficient route for AMP synthesis than de novo synthesis. APT Protein, Streptococcus pyogenes serotype M1 (sf9, His-Myc) is the recombinant APT protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.
- Species: Others
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
APT, also known as adenine phosphoribosyltransferase, plays a crucial role in the rescue reaction that forms AMP (adenosine monophosphate). This salvage pathway provides a more energy-efficient route for AMP synthesis than de novo synthesis. APT Protein, Streptococcus pyogenes serotype M1 (sf9, His-Myc) is the recombinant APT protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.
Background
APT, also known as adenine phosphoribosyltransferase, plays a crucial role in a salvage reaction that enables the formation of AMP (adenosine monophosphate). This salvage pathway offers a more energetically efficient route for AMP synthesis compared to de novo synthesis. By catalyzing the transfer of a phosphoribosyl group from PRPP (5-phosphoribosyl-1-pyrophosphate) to adenine, APT contributes to the recycling and utilization of adenine nucleotides, ensuring their availability for various cellular processes. Understanding the precise mechanisms and regulation of APT-mediated salvage reactions can provide insights into nucleotide metabolism and the maintenance of cellular energy balance.
Technical Parameters
-
Species Others
-
Source Sf9 insect cells
-
Tag N-10*His;C-Myc
-
Accession
P63546 (M1-G172)
-
Gene ID/
-
Molecular Construction
-
N-term
-
10*His
-
APT (M1-G172)
Accession # P63546 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
Adenine phosphoribosyltransferase; EC:2.4.2.7; APRT; apt; SPy_0927; M5005_Spy0728
-
AA Sequence
MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
-
Predicted Molecular Mass
22.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
