1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc)

APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc)

Cat. No.: HY-P72047
Handling Instructions

APT, also known as adenine phosphoribosyltransferase, plays a crucial role in the rescue reaction that forms AMP (adenosine monophosphate). This salvage pathway provides a more energy-efficient route for AMP synthesis than de novo synthesis. APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc) is the recombinant APT protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc) is 172 a.a., with molecular weight of ~22.7 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

APT, also known as adenine phosphoribosyltransferase, plays a crucial role in the rescue reaction that forms AMP (adenosine monophosphate). This salvage pathway provides a more energy-efficient route for AMP synthesis than de novo synthesis. APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc) is the recombinant APT protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc) is 172 a.a., with molecular weight of ~22.7 kDa.

Background

APT, also known as adenine phosphoribosyltransferase, plays a crucial role in a salvage reaction that enables the formation of AMP (adenosine monophosphate). This salvage pathway offers a more energetically efficient route for AMP synthesis compared to de novo synthesis. By catalyzing the transfer of a phosphoribosyl group from PRPP (5-phosphoribosyl-1-pyrophosphate) to adenine, APT contributes to the recycling and utilization of adenine nucleotides, ensuring their availability for various cellular processes. Understanding the precise mechanisms and regulation of APT-mediated salvage reactions can provide insights into nucleotide metabolism and the maintenance of cellular energy balance.

Species

Others

Source

Sf9 insect cells

Tag

N-10*His;C-Myc

Accession

P63546 (M1-G172)

Gene ID

/

Molecular Construction
N-term
10*His
APT (M1-G172)
Accession # P63546
Myc
C-term
Synonyms
apt; SPy_0927; M5005_Spy0728Adenine phosphoribosyltransferase; APRT; EC 2.4.2.7
AA Sequence

MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Molecular Weight

Approximately 22.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APT Protein, Streptococcus pyogenes serotype M1 (Baculovirus, His-Myc)
Cat. No.:
HY-P72047
Quantity:
MCE Japan Authorized Agent: