araA Protein, Anoxybacillus flavithermus (His, CL7)

The araA protein plays a crucial role in cellular metabolism by catalyzing the conversion of L-arabinose into L-ribulose. This enzymatic activity is an integral part of the broader biochemical pathways that control the interconversion of sugars. araA Protein, Anoxybacillus flavithermus (His, CL7) is the recombinant araA protein, expressed by E. coli , with N-6*His, N-CL7 labeled tag.

AraA is a vital enzyme that catalyzes the conversion of L-arabinose to L-ribulose, playing a key role in carbohydrate metabolism. This enzymatic activity is crucial in the interconversion of sugar isomers, facilitating the transformation of L-arabinose into L-ribulose. As a key participant in this metabolic pathway, AraA contributes to the utilization of arabinose in various cellular processes. The specific catalytic function of AraA underscores its significance in the broader context of carbohydrate metabolism, highlighting its role in regulating the availability and utilization of sugar derivatives within the cell.

Others

E. coli

N-6*His;N-CL7

F6KRI7 (M1-R496)

/

Full Length

MLSLRPYEFWFVTGSQHLYGEEALKQVEEHSMMIVNELNQDSVFPFPLVFKSVVTTPEEIRRVCLEANASEQCAGVITWMHTFSPAKMWIGGLLELRKPLLHLHTQFNRDIPWDSIDMDFMNLNQSAHGDREYGFIGARMGVARKVVVGHWEDPEVRERLAKWMRTAVAFAESRDLKVARFGDNMREVAVTEGDKVGAQIQFGWSVNGYGIGDLVQYIRDVSEQKVNELLDEYEELYDIVPAGRQEGPVRESIREQARIELGLKAFLQDGNFTAFTTTFEDLHGMKQLPGLAVQRLMAEGYGFGGEGDWKTAALVRLMKVMADGKGTSFMEDYTYHLEPGNEMILGAHMLEVCPTIAATRPRIEVHPLSIGGKEDPARLVFDGGEGAAVNASLIDLGHRFRLIVNEVDAVKPEHDMPKLPVARILWKPRPSLRDSAEAWILAGGAHHTCFSFAVTTEQLQDFAEMAGIECVVINEHTSVSSFKNELKWNEVFWRGR

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.