Arginase-2/ARG2 Protein, Human (His)
Based on 1 Customer Validation
Arginase-2/ARG2 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Arginase-2 (Arg2) acts as a fasting-induced hepatocyte factor that protects against hepatic and peripheral fat accumulation, hepatic inflammatory responses, and insulin and glucose intolerance in obese murine models.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Arginase-2/ARG2 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Arginase-2 (Arg2) acts as a fasting-induced hepatocyte factor that protects against hepatic and peripheral fat accumulation, hepatic inflammatory responses, and insulin and glucose intolerance in obese murine models[1].
Background
Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (Arginase-1, Arginase-2) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. Arginase-2 is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney[1].
Verified Bioactivity
Measured by the production of urea during the hydrolysis of arginine. The specific activity is 538330.64 pmol/min/µg, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P78540 (H24-G330)
-
Molecular Construction
-
N-term
-
6*His
-
ARGI2 (H24-G330)
Accession # P78540 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ARG2; Type II Arginase; Arginase 2; Arginase II; Arginase-2, Mitochondrial; L-Arginine Amidinohydrolase; Kidney-Type Arginase; L-Arginine Ureahydrolase; Non-Hepatic Arginase; Nonhepatic Arginase; Arginase, Type II; Kidney Arginase
-
AA Sequence
HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGG
-
Predicted Molecular Mass
34.2 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 7.5.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
