Copy Link Print Information

AKR1C3 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT]).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • AKR1C3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

AKR1C3 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag. Aldo-keto reductase family 1 member C3 (AKR1C3) is a steroidogenic enzyme that plays a crucial role in the conversion of adrenal androgen dehydroepiandrosterone (DHEA) into high-affinity ligands for the androgen receptor (testosterone [T] and dihydrotestosterone [DHT])[1].

Background

AKR1C3, an enzyme involved in the conversion of adrenal androgens into testosterone, is often upregulated in castration-resistant prostate cancer (CRPC). AKR1C3 could be a marker for intratumoral steroidogenesis and subsequently could become a target for secondary hormonal treatment of CRPC[1].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P42330 (M1-Y323)

  • Gene ID
    8644  [NCBI]
  • Molecular Construction
    • N-term
    • ARK1C3 (M1-Y323)
      Accession # P42330
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    AKR1C3; Aldo-Keto Reductase Family 1, Member C3 (3-Alpha Hydroxysteroid Dehydrogenase, Type II), Isoform CRA_a; Prev. HSD17B5; Trans-1,2-Dihydrobenzene-1,2-Diol Dehydrogenase; PGFS; Type IIb 3-Alpha Hydroxysteroid Dehydrogenase; Prostaglandin F Synthase; 3-Alpha-Hydroxysteroid Dehydrogenase Type 2; KIAA0119; 17-Beta-Hydroxysteroid Dehydrogenase Type 5; HAKRB; Hydroxysteroid (17-Beta) Dehydrogenase 5; DDX; Dihydrodiol Dehydrogenase Type I; 3-Alpha Hydroxysteroid Dehydrogenase, Type II; Indanol Dehydrogenase; Testosterone 17-Beta-Dehydrogenase 5; 3-Alpha-HSD Type 2; Chlordecone Reductase Homolog HAKRb; 17-Beta-HSD 5; Dihydrodiol Dehydrogenase X; HluPGFS; Dihydrodiol Dehydrogenase 3; HAKRe; 3-Alpha-HSD Type II, Brain; DD-3; HA1753; DDH1; DD3; Aldo-Keto Reductase Family 1 Member C3; Aldo-Keto Reductase Family 1, Member C3 (3-Alpha Hydroxysteroid Dehydrogenase, Type II)

  • AA Sequence

    MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

  • Predicted Molecular Mass

    37.9 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 6% Sucrose, 2% Glycine, 100 mM NaCl, 0.05% Tween 80, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Agus Rizal A H Hamid, et al. Aldo-keto reductase family 1 member C3 (AKR1C3) is a biomarker and therapeutic target for castration-resistant prostate cancer. Mol Med. 2013 Jan 22;18(1):1449-55. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • AKR1C3 Protein, Human (HEK293, His) Product Image
    1/16
  • AKR1C3 Protein, Human (HEK293, His) Product Image