ATOX1 Protein, Human (His)

ATOX1 Protein plays a crucial role in cellular copper transport, binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, supported by research findings. It interacts with ATP7B and ATP7A. In its dimer form, ATOX1 interacts with SLC31A1, contributing to its stability and controlling intracellular Cu(I) levels. ATOX1 Protein, Human (His) is the recombinant human-derived ATOX1 protein, expressed by E. coli , with N-His labeled tag. The total length of ATOX1 Protein, Human (His) is 68 a.a., with molecular weight of ~9 kDa.

The ATOX1 protein serves a crucial role in cellular copper transport by binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, as indicated by research findings (source: PubMed:24837030). Additionally, it interacts with ATP7B (source: PubMed:10966647) and ATP7A (sources: PubMed:21667063, PubMed:19453293). The protein, in its dimer form, also interacts with SLC31A1 via its C-terminal domain, contributing to ATOX1 stability and controlling intracellular Cu(I) levels (sources: PubMed:24837030, PubMed:26745413).

Human

E. coli

N-His

O00244 (M1-E68)

475  [NCBI]

MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Approximately 9 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.