ATOX1 Protein, Human (His)
Based on 1 Customer Validation
ATOX1 Protein plays a crucial role in cellular copper transport, binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, supported by research findings. It interacts with ATP7B and ATP7A. In its dimer form, ATOX1 interacts with SLC31A1, contributing to its stability and controlling intracellular Cu(I) levels. ATOX1 Protein, Human (His) is the recombinant human-derived ATOX1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ATOX1 Protein plays a crucial role in cellular copper transport, binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, supported by research findings. It interacts with ATP7B and ATP7A. In its dimer form, ATOX1 interacts with SLC31A1, contributing to its stability and controlling intracellular Cu(I) levels. ATOX1 Protein, Human (His) is the recombinant human-derived ATOX1 protein, expressed by E. coli , with N-His labeled tag.
Background
The ATOX1 protein serves a crucial role in cellular copper transport by binding to and delivering cytosolic copper to copper ATPase proteins. This process is integral to cellular antioxidant defense mechanisms. ATOX1 functions as a homodimer, as indicated by research findings (source: PubMed:24837030). Additionally, it interacts with ATP7B (source: PubMed:10966647) and ATP7A (sources: PubMed:21667063, PubMed:19453293). The protein, in its dimer form, also interacts with SLC31A1 via its C-terminal domain, contributing to ATOX1 stability and controlling intracellular Cu(I) levels (sources: PubMed:24837030, PubMed:26745413).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O00244 (M1-E68)
-
Molecular Construction
-
N-term
-
His
-
ATOX1 (M1-E68)
Accession # O00244 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ATOX1; ATX1 (Antioxidant Protein 1, Yeast) Homolog 1; Antioxidant 1 Copper Chaperone; ATX1 Antioxidant Protein 1 Homolog (Yeast); HAH1; ATX1 Antioxidant Protein 1 Homolog; Copper Transport Protein ATOX1; ATX1; Metal Transport Protein ATX1
-
AA Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (234 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
