ATP1B2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The ATP1B2 protein is the non-catalytic component of ATP hydrolase and promotes Na(+)/K(+) ion exchange across the plasma membrane. Its role is critical in mediating cell adhesion of neurons and astrocytes, promoting sticky cell interactions. ATP1B2 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B2 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ATP1B2 protein is the non-catalytic component of ATP hydrolase and promotes Na(+)/K(+) ion exchange across the plasma membrane. Its role is critical in mediating cell adhesion of neurons and astrocytes, promoting sticky cell interactions. ATP1B2 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B2 protein, expressed by HEK293 , with N-His labeled tag.
Background
The ATP1B2 protein functions as the non-catalytic component of the active enzyme responsible for catalyzing ATP hydrolysis coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. While the precise function of the beta-2 subunit remains elusive, it plays a crucial role in mediating cell adhesion for both neurons and astrocytes, contributing to the cohesive interaction between these cells. Additionally, ATP1B2 promotes neurite outgrowth, suggesting its involvement in the intricate processes that regulate the extension of neuronal projections. These cellular functions highlight ATP1B2's significance not only in ion transport but also in mediating adhesion and facilitating the structural development of neural networks.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
P14415 (D68-T290)
-
Molecular Construction
-
N-term
-
His
-
ATP1B2 (D68-T290)
Accession # P14415 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ATP1B2; Sodium Pump Subunit Beta-2; ATPase Na+/K+ Transporting Subunit Beta 2; Adhesion Molecule In Glia; Sodium/Potassium-Transporting ATPase Subunit Beta-2; Sodium/Potassium-Transporting ATPase Beta-2 Chain; AMOG; Sodium/Potassium-Transporting ATPase Su
-
AA Sequence
DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
-
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
