ATP5MG Protein, Bovine (Myc, His)

ATP5MG Protein, an essential part of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. Positioned within the F(0) domain as a minor subunit alongside subunit a, ATP5MG collaborates with various subunits in the overall F-type ATPase complex, including CF(1) and CF(0), to ensure efficient ATP synthesis. ATP5MG Protein, Bovine (Myc, His) is the recombinant bovine-derived ATP5MG protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of ATP5MG Protein, Bovine (Myc, His) is 102 a.a., with molecular weight of ~18.7 kDa.

The ATP5MG protein is an integral component of the mitochondrial membrane ATP synthase, also known as Complex V, responsible for generating ATP from ADP in the presence of a proton gradient produced by the respiratory chain's electron transport complexes. F-type ATPases comprise two primary structural domains: F(1), housing the extramembraneous catalytic core, and F(0), encompassing the membrane proton channel. These domains are interconnected by a central stalk and a peripheral stalk. During the catalytic process, ATP synthesis in the F(1) domain is coordinated with proton translocation through a rotary mechanism involving the central stalk subunits. ATP5MG specifically resides within the F(0) domain, acting as a minor subunit alongside subunit a in the membrane. The overall F-type ATPase complex consists of CF(1), the catalytic core, and CF(0), the membrane proton channel, with CF(0) comprising nine subunits: a, b, c, d, e, f, g, F6, and 8 (or A6L). ATP5MG is a crucial component of the ATP synthase complex, working in collaboration with various subunits to facilitate ATP synthesis.

Bovine

E. coli

N-His;C-Myc

Q28852 (2A-103V)

515696  [NCBI]

AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV

Approximately 18.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.