B7-1/CD80 Protein, Rabbit (HEK293, His)

B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag.

The B7-1/CD80 Protein plays a pivotal role in the costimulatory signal necessary for the activation of T lymphocytes. The induction of T-cell proliferation and cytokine production is contingent upon the binding of CD28 or CTLA-4 to this receptor. As a crucial mediator of immune responses, B7-1/CD80 facilitates the dynamic interplay between T cells and their regulatory receptors, thereby influencing key processes essential for the activation and regulation of T lymphocytes in the immune system.

Rabbit

HEK293

C-6*His

P42070 (G33-Q241)

100009377  [NCBI]

Extracellular Domain

GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ

Approximately 30-50 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.