1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. B7-1/CD80
  5. B7-1/CD80 Protein, Rabbit (HEK293, His)

B7-1/CD80 Protein, Rabbit (HEK293, His)

Cat. No.: HY-P72768
Handling Instructions

B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of B7-1/CD80 Protein, Rabbit (HEK293, His) is 209 a.a., with molecular weight of 30-50 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of B7-1/CD80 Protein, Rabbit (HEK293, His) is 209 a.a., with molecular weight of 30-50 kDa.

Background

The B7-1/CD80 Protein plays a pivotal role in the costimulatory signal necessary for the activation of T lymphocytes. The induction of T-cell proliferation and cytokine production is contingent upon the binding of CD28 or CTLA-4 to this receptor. As a crucial mediator of immune responses, B7-1/CD80 facilitates the dynamic interplay between T cells and their regulatory receptors, thereby influencing key processes essential for the activation and regulation of T lymphocytes in the immune system.

Species

Rabbit

Source

HEK293

Tag

C-6*His

Accession

P42070 (G33-Q241)

Gene ID

100009377  [NCBI]

Molecular Construction
N-term
B7-1 (G33-Q241)
Accession # P42070
6*His
C-term
Synonyms
T-lymphocyte activation antigen CD80; Activation B7-1 antigen; B7; CD80
AA Sequence

GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQ

Molecular Weight

30-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-1/CD80 Protein, Rabbit (HEK293, His)
Cat. No.:
HY-P72768
Quantity:
MCE Japan Authorized Agent: