BAFFR/TNFRSF13C Protein, Human (HEK293, Llama Fc)

BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, Llama Fc) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293, with C-Llama Fc labeled tag.

BAFFR/TNFRSF13C protein is a B-cell receptor that specifically recognizes TNFSF13B/TALL1/BAFF/BLyS. It plays a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to the maintenance of a healthy immune system.

Human

HEK293

C-Llama Fc

Q96RJ3-1 (S7-A71)

115650

Partial

SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

Approximately 42-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.