BamA Protein, E.coli (Myc, His)

BamA is a key member of the outer membrane protein assembly complex (Bam), which concentrates the assembly of β-barrel proteins into the outer membrane. Together with BamD, BamA forms the core mechanism of this process, which relies on the coordinated action of all five subunits. BamA Protein, E.coli (Myc, His) is the recombinant E. coli-derived BamA protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. The total length of BamA Protein, E.coli (Myc, His) is 250 a.a., with molecular weight of ~36.0 kDa.

BamA, a pivotal component of the outer membrane protein assembly complex (Bam), plays a central role in the intricate process of assembling and inserting beta-barrel proteins into the outer membrane. Together with BamD, BamA constitutes the core machinery of this assembly process, and the efficient folding and insertion of substrates into the outer membrane require the coordinated action of all five subunits. BamA's structural features include a beta-barrel with a lateral gate that opens between the first and last strands, facilitating the insertion of substrates into the outer membrane. Acting as a receptor for CdiA-EC93, the contact-dependent growth inhibition effector of E.coli strain EC93, BamA is crucial in mediating this microbial interaction. Notably, its susceptibility to CdiA-EC93 is dependent on the specific BamA variant present, as replacing BamA with homologs from different bacterial strains alters susceptibility. Additionally, BamA's role in CDI appears independent of other components of the Bam complex.

E.coli

E. coli

N-10*His;C-Myc

P0A940 (175A-424G)

944870  [NCBI]

AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG

Approximately 36.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.