BamA Protein, E.coli (Myc, His)
Based on 1 Customer Validation
BamA is a key member of the outer membrane protein assembly complex (Bam), which concentrates the assembly of β-barrel proteins into the outer membrane. Together with BamD, BamA forms the core mechanism of this process, which relies on the coordinated action of all five subunits. BamA Protein, E.coli (Myc, His) is the recombinant E. coli-derived BamA protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
BamA is a key member of the outer membrane protein assembly complex (Bam), which concentrates the assembly of β-barrel proteins into the outer membrane. Together with BamD, BamA forms the core mechanism of this process, which relies on the coordinated action of all five subunits. BamA Protein, E.coli (Myc, His) is the recombinant E. coli-derived BamA protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.
BamA, a pivotal component of the outer membrane protein assembly complex (Bam), plays a central role in the intricate process of assembling and inserting beta-barrel proteins into the outer membrane. Together with BamD, BamA constitutes the core machinery of this assembly process, and the efficient folding and insertion of substrates into the outer membrane require the coordinated action of all five subunits. BamA's structural features include a beta-barrel with a lateral gate that opens between the first and last strands, facilitating the insertion of substrates into the outer membrane. Acting as a receptor for CdiA-EC93, the contact-dependent growth inhibition effector of E.coli strain EC93, BamA is crucial in mediating this microbial interaction. Notably, its susceptibility to CdiA-EC93 is dependent on the specific BamA variant present, as replacing BamA with homologs from different bacterial strains alters susceptibility. Additionally, BamA's role in CDI appears independent of other components of the Bam complex.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P0A940 (A175-G424)
-
Gene ID944870 [NCBI]
-
Molecular Construction
-
N-term
-
10*His
-
BamA (A175-G424)
Accession # P0A940 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
JW0172; b0177; yzzY; yzzN; yaeT; bamA; Omp85; Outer membrane protein assembly factor BamA
-
AA Sequence
AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG
-
Predicted Molecular Mass
36 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4
.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
