Basigin/CD147 Protein, Mouse (HEK293, His-Fc)

The Basigin/CD147 protein is essential for retinal maturation and development, acting as a NXNL1 receptor to promote the survival of retinal cone photoreceptor cells. Basigin/CD147 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived Basigin/CD147 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Basigin/CD147 protein is indispensable for normal retinal maturation and development, acting as a crucial cell surface receptor for NXNL1 and contributing significantly to NXNL1-mediated survival of retinal cone photoreceptors. In collaboration with the glucose transporter SLC16A1/GLUT1 and NXNL1, Basigin/CD147 promotes retinal cone survival by enhancing aerobic glycolysis and facilitating the entry of glucose into photoreceptors. It serves as a signaling receptor for cyclophilins, playing an essential role in PPIA/CYPA and PPIB/CYPB-dependent signaling related to the chemotaxis and adhesion of immune cells. Additionally, Basigin/CD147 is pivotal in targeting the monocarboxylate transporters SLC16A1, SLC16A3, and SLC16A8 to the plasma membrane. Acting as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells, it enhances VEGFA-mediated activation and downstream signaling, promoting angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA and KDR/VEGFR2. Moreover, Basigin/CD147 plays a crucial role in spermatogenesis, mediating interactions between germ cells and Sertoli cells and proving essential for the development and differentiation of germ cells into round spermatids.

Mouse

HEK293

C-hFc;C-His

P18572-2 (A22-R209)

12215  [NCBI]

Partial

AAGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.