Copy Link Print Information

BCA-1/CXCL13 Protein, Rat (His-GST)

Customer Review

Based on 1 Customer Validation

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BCA-1/CXCL13 Protein, Rat (His-GST)
  • BCA-1/CXCL13 Protein, Rat (His-GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The BCA-1/CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Background

The BCA-1/CXCL13 protein is a member of the intercrine alpha (chemokine CxC) family, signifying its role within a group of chemokines essential for intercellular communication and immune responses. As part of the intercrine alpha family, BCA-1/CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil the specific functions and implications of this protein within the broader context of the chemokine CxC family, underscoring its significance in mediating immune responses.

Verified Bioactivity

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR5. The ED50 for this effect is 1.049 μg/mL, corresponding to a specific activity is 953.289 U/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR5. The ED50 for this effect is 1.049 μg/mL, corresponding to a specific activity is 953.289 U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-GST;N-6*His
  • Accession

    Q5I0J6 (L23-A108)

  • Gene ID
    498335  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-GST
    • CXCL13 (L23-A108)
      Accession # Q5I0J6
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL13; C-X-C Motif Chemokine 13; Prev. SCYB13; CXC Chemokine BLC; BCA-1; BCA1; BLC; B-Cell-Homing Chemokine (Ligand For Burkitt'S Lymphoma Receptor-1); ANGIE2; Chemokine (C-X-C Motif) Ligand 13 (B-Cell Chemoattractant); BLR1L; Chemokine (C-X-C Motif) Lig

  • AA Sequence

    LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

  • Predicted Molecular Mass

    36.8 kDa

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR5. The ED50 for this effect is 1.049 μg/mL, corresponding to a specific activity is 953.289 U/mg.

  • BCA-1/CXCL13 Protein, Rat (His-GST) Product Image
    1/16
  • Experimental Validation Results for BCA-1/CXCL13 Protein, Rat (His-GST)
  • BCA-1/CXCL13 Protein, Rat (His-GST) Product Image