BCA-1/CXCL13 Protein, Rat (His-GST)

BCA-1/CXCL13 Protein, a member of the intercrine alpha family, is vital for chemokines involved in intercellular communication and immune responses. As part of this family, BCA-1/CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil specific functions and implications within the broader chemokine CxC family, underscoring its significance in mediating immune responses. BCA-1/CXCL13 Protein, Rat (His-GST) is the recombinant rat-derived BCA-1/CXCL13 protein, expressed by E. coli, with N-GST, N-6*His labeled tag. The total length of BCA-1/CXCL13 Protein, Rat (His-GST) is 86 a.a., with molecular weight of 41 kDa.

The BCA-1/CXCL13 protein is a member of the intercrine alpha (chemokine CxC) family, signifying its role within a group of chemokines essential for intercellular communication and immune responses. As part of the intercrine alpha family, BCA-1/CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil the specific functions and implications of this protein within the broader context of the chemokine CxC family, underscoring its significance in mediating immune responses.

Rat

E. coli

N-GST

Q5I0J6 (L23-A108)

498335  [NCBI]

LETHYTNLKCRCSKVSSTFINLILVDWIQVIRPGNGCPKTEIIFWTKAKKAICVNPTARWLPKVLKFVRRSITSTPQAPVSKKRAA

41 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.