BCL2 Protein, Rat (Cell-Free, His)

The BCL2 protein is critical for inhibiting apoptosis in different cellular systems and regulates cell death by controlling mitochondrial membrane permeability. BCL2 operates in a feedback loop with caspases, inhibiting caspase activity by preventing cytochrome c release and binding to apoptosis-activating factor (APAF-1). BCL2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived BCL2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The BCL2 protein is critical for inhibiting apoptosis in different cellular systems and regulates cell death by controlling mitochondrial membrane permeability. BCL2 operates in a feedback loop with caspases, inhibiting caspase activity by preventing cytochrome c release and binding to apoptosis-activating factor (APAF-1). BCL2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived BCL2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

The BCL2 protein is involved in suppressing apoptosis, or programmed cell death, in various cell systems, including factor-dependent lymphohematopoietic and neural cells. It regulates cell death by controlling the permeability of the mitochondrial membrane. BCL2 functions in a feedback loop system with caspases, inhibiting their activity by preventing the release of cytochrome c from the mitochondria and/or binding to the apoptosis-activating factor (APAF-1). Additionally, BCL2 acts as an inhibitor of autophagy, interacting with BECN1 and AMBRA1 to inhibit their autophagy function. It may also attenuate inflammation by impairing NLRP1-inflammasome activation, CASP1 activation, and IL1B release. BCL2 forms homodimers and heterodimers with BAX, BAD, BAK, and Bcl-X(L). Heterodimerization with BAX is necessary for its anti-apoptotic activity. BCL2 interacts with various proteins, including EI24, APAF1, BBC3, BCL2L1, BNIPL, MRPL41, TP53BP2, FKBP8, BAG1, RAF1, EGLN3, G0S2, RTL10/BOP, SCF(FBXO10) complex, NLRP1, GIMAP3/IAN4, GIMAP4/IAN1, GIMAP5/IAN5, BCAP31, IRF3, BECN1, and AMBRA1. These interactions have various effects on BCL2 activity, such as targeting it to the mitochondria or inhibiting its anti-apoptotic function.

Technical Parameters

  • Species Rat
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • BCL2 (M1-K236)
      Accession # P49950
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    BCL2; Protein Phosphatase 1, Regulatory Subunit 50; BCL2 Apoptosis Regulator; B-Cell CLL/Lymphoma 2; Apoptosis Regulator Bcl-2; BCL2, Apoptosis Regulator; PPP1R50; BCL2 Protein; Bcl-2

  • AA Sequence

    MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

  • Predicted Molecular Mass

    28.1 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00