BCL2 Protein, Rat (Cell-Free, His)
The BCL2 protein is critical for inhibiting apoptosis in different cellular systems and regulates cell death by controlling mitochondrial membrane permeability. BCL2 operates in a feedback loop with caspases, inhibiting caspase activity by preventing cytochrome c release and binding to apoptosis-activating factor (APAF-1). BCL2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived BCL2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Rat
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The BCL2 protein is critical for inhibiting apoptosis in different cellular systems and regulates cell death by controlling mitochondrial membrane permeability. BCL2 operates in a feedback loop with caspases, inhibiting caspase activity by preventing cytochrome c release and binding to apoptosis-activating factor (APAF-1). BCL2 Protein, Rat (Cell-Free, His) is the recombinant rat-derived BCL2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
The BCL2 protein is involved in suppressing apoptosis, or programmed cell death, in various cell systems, including factor-dependent lymphohematopoietic and neural cells. It regulates cell death by controlling the permeability of the mitochondrial membrane. BCL2 functions in a feedback loop system with caspases, inhibiting their activity by preventing the release of cytochrome c from the mitochondria and/or binding to the apoptosis-activating factor (APAF-1). Additionally, BCL2 acts as an inhibitor of autophagy, interacting with BECN1 and AMBRA1 to inhibit their autophagy function. It may also attenuate inflammation by impairing NLRP1-inflammasome activation, CASP1 activation, and IL1B release. BCL2 forms homodimers and heterodimers with BAX, BAD, BAK, and Bcl-X(L). Heterodimerization with BAX is necessary for its anti-apoptotic activity. BCL2 interacts with various proteins, including EI24, APAF1, BBC3, BCL2L1, BNIPL, MRPL41, TP53BP2, FKBP8, BAG1, RAF1, EGLN3, G0S2, RTL10/BOP, SCF(FBXO10) complex, NLRP1, GIMAP3/IAN4, GIMAP4/IAN1, GIMAP5/IAN5, BCAP31, IRF3, BECN1, and AMBRA1. These interactions have various effects on BCL2 activity, such as targeting it to the mitochondria or inhibiting its anti-apoptotic function.
Technical Parameters
-
Species Rat
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
P49950 (M1-K236)
-
Gene ID24224
-
Molecular Construction
-
N-term
-
10*His
-
BCL2 (M1-K236)
Accession # P49950 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
BCL2; Protein Phosphatase 1, Regulatory Subunit 50; BCL2 Apoptosis Regulator; B-Cell CLL/Lymphoma 2; Apoptosis Regulator Bcl-2; BCL2, Apoptosis Regulator; PPP1R50; BCL2 Protein; Bcl-2
-
AA Sequence
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDTGDEDSAPLRAAPTPGIFSFQPESNRTPAVHRDTAARTSPLRPLVANAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
-
Predicted Molecular Mass
28.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)