BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, Fc-Avi)

BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, Fc-Avi) is the recombinant cynomolgus-derived BCMA/TNFRSF17 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, Fc-Avi) is 53 a.a., with molecular weight of 42-45 kDa.

The BCMA/TNFRSF17 protein serves as a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, exerting essential functions in promoting B-cell survival and contributing to the regulation of humoral immunity. Through its activation of NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in signaling pathways associated with immune responses. Additionally, it forms associations with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, suggesting its involvement in various cellular processes mediated by these adaptor proteins.

Immobilized Human BAFF Fc at 5 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus / Rhesus macaque BCMA Fc-Avi with a linear range of 0.1-6 ng/mL.

Cynomolgus

HEK293

C-Avi;C-hFc

G7Q0I4 (M1-A53)

102145399  [NCBI]

Partial

Biotin

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA

Approximately 42-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.