1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily B Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily BCMA/CD269
  5. B Cell Maturation Antigen (BCMA)
  6. BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78796
Handling Instructions Technical Support

BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived BCMA/TNFRSF17 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 53 a.a., with molecular weight of 15-18 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BCMA/TNFRSF17 Protein, a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, crucially promotes B-cell survival and regulates humoral immunity. Activating NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in immune response signaling pathways. It associates with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, indicating involvement in various cellular processes mediated by these adaptor proteins. BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived BCMA/TNFRSF17 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 53 a.a., with molecular weight of 15-18 kDa.

Background

The BCMA/TNFRSF17 protein serves as a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL, exerting essential functions in promoting B-cell survival and contributing to the regulation of humoral immunity. Through its activation of NF-kappa-B and JNK, BCMA/TNFRSF17 plays a pivotal role in signaling pathways associated with immune responses. Additionally, it forms associations with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, suggesting its involvement in various cellular processes mediated by these adaptor proteins.

Biological Activity

Immobilized Human APRIL His-Flag at 2 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus / Rhesus macaque BCMA His-Avi with a linear range of 0.2-1 ng/mL.

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-His

Accession

G7Q0I4 (M1-A53)

Gene ID
Protein Length

Partial

Conjugation

Biotin

Synonyms
TNFRSF17; CD269; BCM; BCMA
AA Sequence

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA

Predicted Molecular Mass
9.6 kDa
Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCMA/TNFRSF17 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78796
Quantity:
MCE Japan Authorized Agent: