BD-2 Protein, Human
Based on 1 publication(s) in Google Scholar
BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.
Background
Human β-defensin-2 (HBD-2) is a potent anti-microbial peptide that is part of the innate immune response. HBD-2 is a natural anti-microbial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity[1]. Unlike hBD-1, this second peptide, human beta-defensin-2 (hBD-2), is regulated at a transcriptional level in response to contact with microorganisms, and is highly effective in killing Gram negative bacteria. Its expression is also up-regulated by the cytokine tumor necrosis factor-alpha[2].
Verified Bioactivity
1.Full biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is < 100 ng/mL.
3.Measured by its ability to chemoattract immature human dendritic cells. The ED50 for this effect is 65.16 ng/mL, corresponding to a specific activity is 1.535×104 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Commun Biol
Vibrio cholerae senses human enteric α-defensin 5 through a CarSR two-component system to promote bacterial pathogenicity. [Abstract]2022 Jun 8;5(1):559. PMID: 35676416
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O15263 (G24-P64)
-
Molecular Construction
-
N-term
-
BD-2 (G24-P64)
Accession # O15263 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Defensin beta 4A; Beta-defensin 2; BD-2; hBD-2; Defensin; beta 2; Skin-antimicrobial peptide 1; SAP1; DEFB4A; DEFB102; DEFB2; DEFB4; DEFB4B
-
AA Sequence
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Soto E, et al. Human beta-defensin-2: a natural antimicrobial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity. J Matern Fetal Neonatal Med. 2007 Jan;20(1):15-22. [Content Brief]
[2]. Harder J, et al. Mucoid Pseudomonas aeruginosa, TNF-alpha, and IL-1beta, but not IL-6, induce human beta-defensin-2 in respiratory epithelia. Am J Respir Cell Mol Biol. 2000 Jun;22(6):714-21. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)