BD-2 Protein, Human

BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

Human β-defensin-2 (HBD-2) is a potent anti-microbial peptide that is part of the innate immune response. HBD-2 is a natural anti-microbial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity^[1]. Unlike hBD-1, this second peptide, human beta-defensin-2 (hBD-2), is regulated at a transcriptional level in response to contact with microorganisms, and is highly effective in killing Gram negative bacteria. Its expression is also up-regulated by the cytokine tumor necrosis factor-alpha^[2].

1.Full biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED₅₀ for this effect is 65.46 ng/mL, corresponding to a specific activity is 1.528×10⁴U/mg.

Human

E. coli

Tag Free

O15263 (G24-P64)

1673  [NCBI]

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Approximately 4.3-5 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PBS, pH 7.4, 130 mM NaCl or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Soto E, et al. Human beta-defensin-2: a natural antimicrobial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity. J Matern Fetal Neonatal Med. 2007 Jan;20(1):15-22.  [Content Brief]

  [2]. Harder J, et al. Mucoid Pseudomonas aeruginosa, TNF-alpha, and IL-1beta, but not IL-6, induce human beta-defensin-2 in respiratory epithelia. Am J Respir Cell Mol Biol. 2000 Jun;22(6):714-21.  [Content Brief]