BD-2 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

Background

Human β-defensin-2 (HBD-2) is a potent anti-microbial peptide that is part of the innate immune response. HBD-2 is a natural anti-microbial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity[1]. Unlike hBD-1, this second peptide, human beta-defensin-2 (hBD-2), is regulated at a transcriptional level in response to contact with microorganisms, and is highly effective in killing Gram negative bacteria. Its expression is also up-regulated by the cytokine tumor necrosis factor-alpha[2].

Verified Bioactivity

1.Full biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is < 100 ng/mL.
3.Measured by its ability to chemoattract immature human dendritic cells. The ED50 for this effect is 65.16 ng/mL, corresponding to a specific activity is 1.535×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 65.46 ng/mL, corresponding to a specific activity is 1.528×104 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BD-2 (G24-P64)
      Accession # O15263
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Defensin beta 4A; Beta-defensin 2; BD-2; hBD-2; Defensin; beta 2; Skin-antimicrobial peptide 1; SAP1; DEFB4A; DEFB102; DEFB2; DEFB4; DEFB4B

  • AA Sequence

    GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

  • Molecular Weight

    Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00