1. Recombinant Proteins
  2. Others
  3. BD-2 Protein, Human

BD-2 Protein, Human

Cat. No.: HY-P7135
Handling Instructions

BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

BD-2 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

BD-2 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O15263 (G24-P64)

Gene ID

1673

Synonyms
rHuBD-2; DEFB2
AA Sequence

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Molecular Weight

Approximately 4.3 kDa

Biological Activity
Full biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PBS, pH 7.4, 130 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Human β-defensin-2 (HBD-2) is a potent anti-microbial peptide that is part of the innate immune response. HBD-2 is a natural anti-microbial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity[1]. Unlike hBD-1, this second peptide, human beta-defensin-2 (hBD-2), is regulated at a transcriptional level in response to contact with microorganisms, and is highly effective in killing Gram negative bacteria. Its expression is also up-regulated by the cytokine tumor necrosis factor-alpha[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BD-2 Protein, Human
Cat. No.:
HY-P7135
Quantity:
MCE Japan Authorized Agent: