BD-3 Protein, Human
Based on 1 Customer Validation
BD-3 Protein, Human is an antibacterial peptide that exhibits antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
BD-3 Protein, Human is an antibacterial peptide that exhibits antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant.
Human β-defensin-3 (HβD-3) is the most recently discovered member of the host defense peptide family. HβD-3 has been shown to exhibit antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant. HβD-3 is of special interest for structural and functional studies and also for possible pharmaceutical applications. It is also one among the identified human defensins that has the ability to undergo oligomerization[1].
The ED50 is <30 μg/mL as measured by anti-microbial activity against E.coli, corresponding to a specific activity of >33.3 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P81534 (G23-K67)
-
Gene ID55894 [NCBI]
-
Molecular Construction
-
N-term
-
BD-3 (G23-K67)
Accession # P81534 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DEFB103A; Defensin-Like Protein; Prev. DEFB103; Beta-Defensin 103; Prev. DEFB3; BD-3; Beta-Defensin 3; Defensin, Beta 103A; DEFB-3; Defensin, Beta 3; HBD3; Beta Defensin 3; HBD-3; Beta Defensin-3; HBP-3; BD3; HBP3; Defensin Beta 103A; Defensin, Beta 103
-
AA Sequence
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
-
Predicted Molecular Mass
5.2 kDa
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PBS, pH 7.4, 130 mM NaCl.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
