Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution)

The beta-glucuronidase/GUSB protein displays activity with PNPG and 4-methylumbelliferyl-glucuronide. It scavenges glucuronate from various xenobiotic and endobiotic glucuronides in the GI tract, utilizing diverse carbon sources. As part of the GI microbiome, it can reactivate glucuronide drug conjugates, potentially harming the GI tract. Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution) is the recombinant E. coli-derived Beta-glucuronidase/GUSB protein, expressed by E. coli , with N-6*His labeled tag.

Beta-glucuronidase/GUSB protein exhibits beta-glucuronidase activity, demonstrated with the artificial substrate p-nitrophenyl-beta-D-glucuronide (PNPG) and 4-methylumbelliferyl-glucuronide. This enzymatic capability suggests that GUSB is likely adept at scavenging glucuronate from a variety of chemically distinct xenobiotic and endobiotic glucuronides present in the gastrointestinal (GI) tract, thus utilizing diverse sources of carbon. As a constituent of the GI microbiome, GUSB plays a crucial role in the reactivation of glucuronide drug conjugates. However, the reactivated compounds can pose a significant threat to the GI tract, emphasizing the potential impact of GUSB in drug metabolism and the intricate interplay between microbial enzymes and host physiology in the gastrointestinal environment.

Measured by its ability to hydrolyze Phenolphthalein Glucuronide. The specific activity is ≥1029.5 pmol/min/μg.

E.coli

E. coli

N-6*His

P05804 (M1-Q603)

946149  [NCBI]

Full Length

MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ

Approximately 72 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 or 20mM Hepes-NaOH, 12% Trehalose, 4%Mannitol, 0.05% Tween80, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.