Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution)

Customer Review

Based on 1 Customer Validation

The beta-glucuronidase/GUSB protein displays activity with PNPG and 4-methylumbelliferyl-glucuronide. It scavenges glucuronate from various xenobiotic and endobiotic glucuronides in the GI tract, utilizing diverse carbon sources. As part of the GI microbiome, it can reactivate glucuronide drug conjugates, potentially harming the GI tract. Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution) is the recombinant E. coli-derived Beta-glucuronidase/GUSB protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The beta-glucuronidase/GUSB protein displays activity with PNPG and 4-methylumbelliferyl-glucuronide. It scavenges glucuronate from various xenobiotic and endobiotic glucuronides in the GI tract, utilizing diverse carbon sources. As part of the GI microbiome, it can reactivate glucuronide drug conjugates, potentially harming the GI tract. Beta-glucuronidase/GUSB Protein, E.coli (N-His, solution) is the recombinant E. coli-derived Beta-glucuronidase/GUSB protein, expressed by E. coli , with N-6*His labeled tag.

Background

Beta-glucuronidase/GUSB protein exhibits beta-glucuronidase activity, demonstrated with the artificial substrate p-nitrophenyl-beta-D-glucuronide (PNPG) and 4-methylumbelliferyl-glucuronide. This enzymatic capability suggests that GUSB is likely adept at scavenging glucuronate from a variety of chemically distinct xenobiotic and endobiotic glucuronides present in the gastrointestinal (GI) tract, thus utilizing diverse sources of carbon. As a constituent of the GI microbiome, GUSB plays a crucial role in the reactivation of glucuronide drug conjugates. However, the reactivated compounds can pose a significant threat to the GI tract, emphasizing the potential impact of GUSB in drug metabolism and the intricate interplay between microbial enzymes and host physiology in the gastrointestinal environment.

Verified Bioactivity

Measured by its ability to hydrolyze Phenolphthalein Glucuronide. The specific activity is ≥1029.5 pmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • GUSB (M1-Q603)
      Accession # P05804
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    uidA; gurA; gusA; b1617; JW1609; Beta-glucuronidase; GUS; EC 3.2.1.31; Beta-D-glucuronoside glucuronosohydrolase; EcGUS; UID

  • AA Sequence

    MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ

  • Predicted Molecular Mass

    69.9 kDa

  • Molecular Weight

    Approximately 75 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4 or 20mM Hepes-NaOH, 12% Trehalose, 4%Mannitol, 0.05% Tween80, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00