Biglycan Protein, Human (HEK293, His)

Biglycan Protein, Human (HEK293, His) is a recombinant human Biglycan produced in HEK293 cells with a His tag. Biglycan, a small leucine-rich proteoglycan, acts as a danger signal and is classically thought to promote macrophage recruitment via Toll-like receptors (TLR) 2 and 4^[1].

Biglycan, a member of the family of small leucine-rich proteoglycans, is composed of glycosaminoglycan side chains covalently bound to a central core protein. It resides at the cell surface or in the pericellular space of various tissues. Biglycan has been implicated in the development and progression of human cancers^[2].

Measured by its ability to inhibit the cell growth of NIH-3T3 cells. The ED₅₀ this effect is 1.427 μg/mL, corresponding to a specific activity is 700.7708 units/mg.

• 
  Measured by its ability to inhibit the cell growth of NIH-3T3 cells. The ED₅₀ for this effect is 1.427 μg/mL, corresponding to a specific activity is 700.7708 units/mg.

Human

HEK293

C-6*His

P21810 (E20-K368)

633  [NCBI]

EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKHHHHHH

40-90 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wang B, et al. Biglycan expression correlates with aggressiveness and poor prognosis of gastric cancer. Exp Biol Med (Maywood). 2011;236(11):1247-1253.  [Content Brief]

  [2]. Poluzzi C, et al. Biglycan evokes autophagy in macrophages via a novel CD44/Toll-like receptor 4 signaling axis in ischemia/reperfusion injury. Kidney Int. 2019;95(3):540-562.  [Content Brief]