1. Recombinant Proteins
  2. Others
  3. Blot21 Protein, Blomia tropicalis (HEK293, His)

Blot21 Protein, Blomia tropicalis (HEK293, His)

Cat. No.: HY-P77307
Handling Instructions Technical Support

Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (HEK293, His) is the recombinant Blot21 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (HEK293, His) is the recombinant Blot21 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

Blot21, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 consists of three anti-parallel α-helices assembled in a helical bundle resembling that of Blot5 and Derp5[1][2].

Species

Others

Source

HEK293

Tag

N-6*His

Accession

AAX34047 (L17-E129)

Gene ID

/

Molecular Construction
N-term
6*His
Blot21 (L17-E129)
Accession # AAX34047
C-term
Protein Length

Partial

Synonyms
Mite allergen Blo t 21; Mite group 21 allergen Blo t 21; Blo t 21
AA Sequence

LPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE

Predicted Molecular Mass
16.3 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Blot21 Protein, Blomia tropicalis (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Blot21 Protein, Blomia tropicalis (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Blot21 Protein, Blomia tropicalis (HEK293, His)
Cat. No.:
HY-P77307
Quantity:
MCE Japan Authorized Agent: