1. Recombinant Proteins
  2. Others
  3. BLOT5 Protein, Blomia tropicalis (P.pastoris, His)

BLOT5 Protein, Blomia tropicalis (P.pastoris, His)

Cat. No.: HY-P76748
Handling Instructions Technical Support

BLOT5 protein exhibits potential homodimeric and homotrimeric forms and is detected in midgut and hindgut contents as well as fecal pellets. Its presence suggests a role in different physiological processes within these regions. BLOT5 Protein, Blomia tropicalis (P.pastoris, His) is the recombinant BLOT5 protein, expressed by P. pastoris , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BLOT5 protein exhibits potential homodimeric and homotrimeric forms and is detected in midgut and hindgut contents as well as fecal pellets. Its presence suggests a role in different physiological processes within these regions. BLOT5 Protein, Blomia tropicalis (P.pastoris, His) is the recombinant BLOT5 protein, expressed by P. pastoris , with C-His labeled tag.

Background

The BLOT5 protein presents the potential to exist in a homodimeric and homotrimeric form. Notably, it is detected in midgut and hindgut contents, as well as in fecal pellets at the protein level. These observations suggest that BLOT5 may play a role in specific physiological processes or cellular activities within the midgut and hindgut regions. The potential presence of BLOT5 in different oligomeric states hints at its structural versatility, raising questions about its functional significance and involvement in molecular interactions. Further investigation is warranted to elucidate the specific functions and molecular mechanisms associated with BLOT5, particularly in the context of midgut and hindgut physiology.

Species

Others

Source

P. pastoris

Tag

C-His

Accession

O96870 (Q18-Q134)

Gene ID

/

Molecular Construction
N-term
BLOT5 (Q18-Q134)
Accession # O96870
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Mite allergen Blo t 5; Allergen: Blo t 5
AA Sequence

QEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

Predicted Molecular Mass
15.3 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BLOT5 Protein, Blomia tropicalis (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BLOT5 Protein, Blomia tropicalis (P.pastoris, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BLOT5 Protein, Blomia tropicalis (P.pastoris, His)
Cat. No.:
HY-P76748
Quantity:
MCE Japan Authorized Agent: