BNIP3/NIP3 Protein, Human (His)
Based on 1 Customer Validation
BNIP3/NIP3 Protein, Human (His) expresses in E. coliwith a His tag. BNIP3 belongs to the Bcl-2 protein family that regulates programmed cell death.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
BNIP3/NIP3 Protein, Human (His) expresses in E. coliwith a His tag. BNIP3 belongs to the Bcl-2 protein family that regulates programmed cell death[1].
Background
BNIP3 is an atypical BH3-only protein that is induced by hypoxia-inducible factor 1 (HIF1) under hypoxia[2].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human BNIP3 Protein at 2 μg/mL (100 μL/well) can bind Anti-BNIP3 Antibody, The ED50 for this effect is 13.08 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
AAH21989.1 (M1-L166)
-
Molecular Construction
-
N-term
-
6*His
-
BNIP3 (M1-L166)
Accession # AAH21989.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BNIP3; BCL2/Adenovirus E1B 19kDa Interacting Protein 3; BCL2 Interacting Protein 3; BCL2/Adenovirus E1B Interacting Protein 3; HABON; Nineteen KD Interacting Protein-3; Nip3; CDNA FLJ60537, Highly Similar To BCL2/Adenovirus E1B 19 KDa Protein-Interacting
-
AA Sequence
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFL
-
Molecular Weight
Approximately 22-28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Swoboda E, et al. BNIP3 jako nietypowy przedstawiciel rodziny Bcl-2. Cześć 2: Regulacja ekspresji i aktywności BNIP3 oraz jego rola w chorobie nowotworowej [BNIP3 as an atypical representative of the Bcl-2 protein family. Part 2: Regulation of the expression and activity of BNIP3 protein and its role in tumorigenesis]. Postepy Hig Med Dosw (Online). 2009;63:418-424. Published 2009 Sep 10. [Content Brief]
[2]. Park CW, et al. BNIP3 is degraded by ULK1-dependent autophagy via MTORC1 and AMPK. Autophagy. 2013;9(3):345-360. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
