1. Protéines recombinantes
  2. Others
  3. CA12/Carbonic Anhydrase 12 Protein, Cynomolgus (HEK293, His)

CA12/Carbonic Anhydrase 12 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P703776
Instruction de manipulation Technical Support

CA12/Carbonic anhydrase 12 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CA12/Carbonic anhydrase XII protein, expressed by HEK293, with C-His tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

CA12/Carbonic anhydrase 12 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CA12/Carbonic anhydrase XII protein, expressed by HEK293, with C-His tag.

Background

CA12 (Carbonic anhydrase XII) is a carbonic anhydrase enzyme that primarily catalyzes the reversible hydration of carbon dioxide. It plays roles in various physiological processes including pH regulation and ion transport. by similar: Other carbonic anhydrase family members (e.g., CA2 and CA9) are also involved in similar biochemical reactions.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5TSB2 (A25-G299)

Protein Length

Extracellular Domain

AA Sequence

APANGSKWTYLGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLMPLEFQGYNLSANEQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGPFNPSYDKIFSHLQHVKYKGQEAFIPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQAYTAAG

Predicted Molecular Mass
32 kDa
Masse moléculaire

Approximately 40-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Pureté

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CA12/Carbonic Anhydrase 12 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

CA12/Carbonic Anhydrase 12 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
CA12/Carbonic Anhydrase 12 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P703776
Quantité:
MCE Japan Authorized Agent: