1. Recombinant Proteins
  2. Calreticulin-3 Protein, Human

Calreticulin-3 Protein, Human

Cat. No.: HY-P7712
Handling Instructions

Calreticulin-3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER)[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $105 Ask For Quote & Lead Time
50 μg $314 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCalreticulin-3; Calreticulin-3; calreticulin-2; calsperin; CALR3; CRT2
Species

Human

Source

E. coli

Accession

Q96L12 (T20-L384)

Gene ID

125972

Molecular Weight

Approximately 42.0 kDa

AA Sequence

TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150mM NaCl, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The C-terminal domain of CRT3, which is rich in basic residues, is essential for retaining bri1-9 in the ER. CRT1 and CRT2, similar to the mammalian CRT1, have an acidic C-terminal domain and are co-expressed with known ER chaperones and folding catalysts, whereas CRT3 has a C-terminal domain enriched with basic residues such as histidine (His or H), arginine (Arg or R) and lysine (Lys or K) and is co-expressed with genes involved in plant stress responses[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calreticulin-3 Protein, Human
Cat. No.:
HY-P7712
Quantity:
MCE Japan Authorized Agent: