Calreticulin-3/CALR3 Protein, Human
Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER).
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER)[1].
The C-terminal domain of CRT3, which is rich in basic residues, is essential for retaining bri1-9 in the ER. CRT1 and CRT2, similar to the mammalian CRT1, have an acidic C-terminal domain and are co-expressed with known ER chaperones and folding catalysts, whereas CRT3 has a C-terminal domain enriched with basic residues such as histidine (His or H), arginine (Arg or R) and lysine (Lys or K) and is co-expressed with genes involved in plant stress responses[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q96L12 (T20-L384)
-
Molecular Construction
-
N-term
-
CALR3 (T20-L384)
Accession # Q96L12 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CALR3; Calreticulin-2; Calreticulin 3; FLJ25355; CRT2; MGC26577; Calsperin; Testis Secretory Sperm-Binding Protein Li 226n; CT93; Calreticulin; Cancer/Testis Antigen 93; CMH19; Calreticulin-3
-
AA Sequence
TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
-
Predicted Molecular Mass
42.9 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
