1. Recombinant Proteins
  2. Others
  3. Calreticulin-3/CALR3 Protein, Human

Calreticulin-3/CALR3 Protein, Human

Cat. No.: HY-P7712
Handling Instructions

Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER).

For research use only. We do not sell to patients.

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Calreticulin-3/CALR3 Protein, Human is a recombinant human Calreticulin-3 expressed in E. coli. Calreticulin (CRT) is a highly conserved chaperone-like lectin that regulates Ca2+ homeostasis and participates in protein quality control in the endoplasmic reticulum (ER)[1].

Background

The C-terminal domain of CRT3, which is rich in basic residues, is essential for retaining bri1-9 in the ER. CRT1 and CRT2, similar to the mammalian CRT1, have an acidic C-terminal domain and are co-expressed with known ER chaperones and folding catalysts, whereas CRT3 has a C-terminal domain enriched with basic residues such as histidine (His or H), arginine (Arg or R) and lysine (Lys or K) and is co-expressed with genes involved in plant stress responses[1].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q96L12 (T20-L384)

Gene ID
Synonyms
rHuCalreticulin-3; Calreticulin-3; calreticulin-2; calsperin; CALR3; CRT2
AA Sequence

TVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL

Molecular Weight

Approximately 42.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

Calreticulin-3/CALR3 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calreticulin-3/CALR3 Protein, Human
Cat. No.:
HY-P7712
Quantity:
MCE Japan Authorized Agent: