Canf4 Protein, Canine (HEK293, His)

Canf4 Protein, Canine (HEK293, His), an IgE-binding dog dander protein, is an important respiratory allergen. Canf4 Protein is a dog allergen of the lipocalin family^[1]. Canf4 Protein, Canine (HEK293, His) is the recombinant canine-derived Canf4 protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of Canf4 Protein, Canine (HEK293, His) is 158 a.a., with molecular weight of ~19 KDa.

Dog dander is a common cause of respiratory allergy, with symptoms including rhinitis, conjunctivitis and bronchial asthma. Extracts of dog hair and dander contain a complexity of allergenic and non-allergenic proteins. To date, the IgE reactivity of 4 dog allergens of the lipocalin protein family, Canf1, Canf2, Canf4, and Canf6, as well as the dog serum albumin Canf3 and the dog prostatic kallikrein Canf5, has been characterized in detail. The size and the amino acid composition of the ligand-binding pocket indicate that Canf4 is capable of binding only relatively small hydrophobic molecules which are different from those that Canf2 is able to bind. The crystal structure of Canf4 contained both monomeric and dimeric forms of the allergen, suggesting that Canf4 is able to form transient (weak) dimers. The dimeric structure of Canf4 is formed when the ends of four β-strands are packed against the same strands from the second monomer^[1][2].

Canine

HEK293

C-His;C-6*His

NP_001177855.1 (Q17-E174)

100463491  [NCBI]

QLPLPNVLTQVSGPWKTLYISSNNLDKIGDNGPFRIYMRGINVDIPRLKMSFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNVDSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPNHE

Approximately 19 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.