1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 13 (CA-XIII)
  5. Carbonic Anhydrase 13 Protein, Human (His)

Carbonic Anhydrase 13 Protein, Human (His)

Cat. No.: HY-P7726
COA Handling Instructions

Carbonic Anhydrase 13 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Human Carbonic Anhydrase 13, a member of the human carbonic anhydrase (hCA), can control pH and ion balance regulation.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $70 In-stock
50 μg $210 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Carbonic Anhydrase 13 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Human Carbonic Anhydrase 13, a member of the human carbonic anhydrase (hCA), can control pH and ion balance regulation[1].

Background

The cytosolic isoform XIII is a recently discovered member of the human carbonic anhydrase (hCA, EC 4.2.1.1) family. It is selectively expressed among other tissues in the reproductive organs, where it may control pH and ion balance regulation, ensuring thus proper fertilization conditions[1].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q8N1Q1 (M1-F261)

Gene ID
Molecular Construction
N-term
CA13 (M1-F261)
Accession # Q8N1Q1
6*His
C-term
Synonyms
rHuCarbonic Anhydrase 13, His; Carbonic Anhydrase 13; Carbonate Dehydratase XIII; Carbonic Anhydrase XIII; CA13
AA Sequence

MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFHHHHHHH

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Carbonic Anhydrase 13 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 13 Protein, Human (His)
Cat. No.:
HY-P7726
Quantity:
MCE Japan Authorized Agent: