Carbonic Anhydrase 14 Protein, Mouse (HEK293, His)
The carbonic anhydrase 14 (CA14) protein catalyzes the reversible hydration of carbon dioxide, converting it into bicarbonate ions and protons.Its enzymatic activity is essential for physiological processes, regulating pH and maintaining acid-base balance.Carbonic Anhydrase 14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The carbonic anhydrase 14 (CA14) protein catalyzes the reversible hydration of carbon dioxide, converting it into bicarbonate ions and protons.Its enzymatic activity is essential for physiological processes, regulating pH and maintaining acid-base balance.Carbonic Anhydrase 14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The Carbonic Anhydrase 14 (CA14) protein is responsible for the reversible hydration of carbon dioxide, playing a key role in catalyzing the conversion of carbon dioxide to bicarbonate ions and protons. This enzymatic activity is fundamental in various physiological processes, contributing to the regulation of pH levels and the maintenance of acid-base balance. As a member of the carbonic anhydrase family, CA14 participates in the crucial biochemical reactions involved in carbon dioxide transport and buffering in tissues, emphasizing its significance in cellular homeostasis.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9WVT6 (A16-M290)
-
Molecular Construction
-
N-term
-
Ca14 (A16-M290)
Accession # Q9WVT6 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CA14; CA-XIV; Carbonic Anhydrase 14; Carbonic Dehydratase; Carbonic Anhydrase XIV; Carbonic Anhydrase; Carbonate Dehydratase XIV; CAXiV
-
AA Sequence
ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
-
Predicted Molecular Mass
31.8 kDa
-
Molecular Weight
Approximately 41-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
