Carbonic Anhydrase 14 Protein, Mouse (275a.a, HEK293, His)

The carbonic anhydrase 14 (CA14) protein catalyzes the reversible hydration of carbon dioxide, converting it into bicarbonate ions and protons. Its enzymatic activity is essential for physiological processes, regulating pH and maintaining acid-base balance. Carbonic Anhydrase 14 Protein, Mouse (275a.a, HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Carbonic Anhydrase 14 Protein, Mouse (275a.a, HEK293, His) is 275 a.a., with molecular weight of 41-50 kDa.

The Carbonic Anhydrase 14 (CA14) protein is responsible for the reversible hydration of carbon dioxide, playing a key role in catalyzing the conversion of carbon dioxide to bicarbonate ions and protons. This enzymatic activity is fundamental in various physiological processes, contributing to the regulation of pH levels and the maintenance of acid-base balance. As a member of the carbonic anhydrase family, CA14 participates in the crucial biochemical reactions involved in carbon dioxide transport and buffering in tissues, emphasizing its significance in cellular homeostasis.

Mouse

HEK293

C-6*His

Q9WVT6 (A16-M290)

23831  [NCBI]

ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

41-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.