Carbonic Anhydrase 14 Protein, Mouse (His)
Carbonic Anhydrase 14 Protein, Mouse (His) is an approximately 40.0 kDa mouse carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Carbonic Anhydrase 14 Protein, Mouse (His) is an approximately 40.0 kDa mouse carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system[1].
Background
Carbonic AnHYdrase XIV is a type I membrane enzyme highly expressed in all parts of the central nervous system. And it exhibits lower expression in adult liver, heart, kidney, urinary bladder, and skeletal muscle[1].The carbonic anhydrasekl (CA) family consists of at least 11 enzymatically active members and a few inactive homologous proteins[2].The carbonic anhydrases are indentified as metalloenzyme for its zinc ion prosthetic group, it can catalyze the rapid interconversion of carbon dioxide and water to bicarbonate and protons. They also take part in maintaining acid-base balance in blood and other tissues[2].
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9WVT6 (A16-M290)
-
Molecular Construction
-
N-term
-
6*His
-
Ca14 (A16-M290)
Accession # Q9WVT6 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CA14; CA-XIV; Carbonic Anhydrase 14; Carbonic Dehydratase; Carbonic Anhydrase XIV; Carbonic Anhydrase; Carbonate Dehydratase XIV; CAXiV
-
AA Sequence
ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
-
Predicted Molecular Mass
32.3 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. K Fujikawa-Adachi, et al. Human carbonic anhydrase XIV (CA14): cDNA cloning, mRNA expression, and mapping to chromosome 1. Genomics. 1999 Oct 1;61(1):74-81. [Content Brief]
[2]. D Hewett-Emmett, et al. Functional diversity, conservation, and convergence in the evolution of the alpha-, beta-, and gamma-carbonic anhydrase gene families. Mol Phylogenet Evol [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
