1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4)
  4. Carbonic Anhydrase 14 Protein, Mouse (His)

Carbonic Anhydrase 14 Protein, Mouse (His)

Cat. No.: HY-P7728
Handling Instructions

Carbonic Anhydrase 14 Protein, Mouse (His) is an approximately 40.0 kDa mouse carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $105 Ask For Quote & Lead Time
50 μg $314 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Carbonic Anhydrase 14 Protein, Mouse (His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Accession

Q9WVT6 (A16-M290)

Gene ID

23831

Synonyms
rMuCarbonic Anhydrase 14, His; Carbonic Anhydrase 14; Carbonate Dehydratase XIV; Carbonic Anhydrase XIV; CA14;
AA Sequence

HHHHHHADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Molecular Weight

Approximately 40.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Carbonic AnHYdrase XIV is a type I membrane enzyme highly expressed in all parts of the central nervous system. And it exhibits lower expression in adult liver, heart, kidney, urinary bladder, and skeletal muscle[1].
The carbonic anhydrasekl (CA) family consists of at least 11 enzymatically active members and a few inactive homologous proteins[2].
The carbonic anhydrases are indentified as metalloenzyme for its zinc ion prosthetic group, it can catalyze the rapid interconversion of carbon dioxide and water to bicarbonate and protons. They also take part in maintaining acid-base balance in blood and other tissues[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 14 Protein, Mouse (His)
Cat. No.:
HY-P7728
Quantity:
MCE Japan Authorized Agent: