Carbonic Anhydrase 3 Protein, Human (His)
Based on 1 Customer Validation
Carbonic Anhydrase 3 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 3 (CA III) is a zinc metalloenzyme known to catalyze the reversible hydration of CO2 to HCO3-.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Carbonic Anhydrase 3 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 3 (CA III) is a zinc metalloenzyme known to catalyze the reversible hydration of CO2 to HCO3-[1].
Background
Carbonic anhydrase III (CAIII) is a metabolic enzyme and a regulator for intracellular pH. CAIII is an ~30-kDa cytosolic protein present at high levels in liver, adipocytes, and skeletal muscles. It is a low activity enzyme among CA isozymes but is resistant to most sulfonamide inhibitors. CAIII may facilitate rapid conversion of glycolytic intermediates to oxaloacetate and citrate and stimulate their incorporation into fatty acids[2].
Verified Bioactivity
Measured by its esterase activity.The specific activity is >5 pmoles/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-His
-
Accession
NP_005172.1 (M1-K260)
-
Molecular Construction
-
N-term
-
CA3 (M1-K260)
Accession # NP_005172.1 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CA3; Carbonic Anhydrase III; Carbonic Anhydrase 3; CA-III; CAIII; Epididymis Secretory Sperm Binding Protein Li 167mP; Car3; Carbonic Anhydrase IIII; Carbonic Anhydrase III, Muscle Specific; Carbonic Anhydrase; Carbonate Dehydratase III; HEL-S-167mP
-
AA Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
-
Predicted Molecular Mass
30.4 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 25 mM Tris, 150 mM NaCl, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
