1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 3 (CA-III)
  5. Carbonic Anhydrase 3 Protein, Human (His)

Carbonic Anhydrase 3 Protein, Human (His)

Cat. No.: HY-P7719
COA Handling Instructions

Carbonic Anhydrase 3 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 3 (CA III) is a zinc metalloenzyme known to catalyze the reversible hydration of CO2 to HCO3-.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $90 In-stock
10 μg $155 In-stock
50 μg $433 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Carbonic Anhydrase 3 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase 3 (CA III) is a zinc metalloenzyme known to catalyze the reversible hydration of CO2 to HCO3-[1].

Background

Carbonic anhydrase III (CAIII) is a metabolic enzyme and a regulator for intracellular pH. CAIII is an ~30-kDa cytosolic protein present at high levels in liver, adipocytes, and skeletal muscles. It is a low activity enzyme among CA isozymes but is resistant to most sulfonamide inhibitors. CAIII may facilitate rapid conversion of glycolytic intermediates to oxaloacetate and citrate and stimulate their incorporation into fatty acids[2].

Biological Activity

Measured by its esterase activity.The specific activity is >5 pmoles/min/μg.

Species

Human

Source

E. coli

Tag

C-His

Accession

NP_005172.1 (A1-K260)

Gene ID

761  [NCBI]

Molecular Construction
N-term
CA3 (A1-K260)
Accession # NP_005172.1
His
C-term
Synonyms
rHuCarbonic Anhydrase 3, His; Carbonic Anhydrase 3; Carbonate Dehydratase III; Carbonic Anhydrase III; CA3
AA Sequence

MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK

Molecular Weight

28-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 25mM Tris, 150 mM NaCl, pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Carbonic Anhydrase 3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 3 Protein, Human (His)
Cat. No.:
HY-P7719
Quantity:
MCE Japan Authorized Agent: