Carbonic Anhydrase 4 Protein, Human (His)
Based on 1 Customer Validation
Carbonic Anhydrase 4 Protein, Human (His) a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3-.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Carbonic Anhydrase 4 Protein, Human (His) a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3-[1].
Background
The human carbonic anhydrase IV (CA4) gene, located on chromosome 17q22, was the first identified membrane-bound isozyme in the 16-member carbonic anhydrase (CA) gene family and contains 1,170 base pairs. The CA4 enzyme is involved in the formation of gastric acid and participates in acid-base homeostasis. CA4 is expressed in normal human stomach tissues. CA4 may serve an important role in gastric cancer (GC) tumorigenesis by inhibiting cellular proliferation via regulating the expression of cell cycle‑associated proteins. CA4 may serve as a diagnostic biomarker and a potential therapeutic target in GC[1].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P22748-1 (A19-K283)
-
Molecular Construction
-
N-term
-
CA4 (A19-K283)
Accession # P22748-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Alpha-carbonic anhydrase Domain
-
Synonyms
CA4; CAIV; Prev. RP17; CA-IV; Carbonic Anhydrase IV; Retinitis Pigmentosa 17 (Autosomal Dominant); Carbonate Dehydratase IV; Carbonic Dehydratase IV; Carbonic Anhydrase 4; Car4
-
AA Sequence
AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK
-
Predicted Molecular Mass
31.4 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
