Carbonic Anhydrase 4 Protein, Human (His)

Carbonic Anhydrase 4 Protein, Human (His) a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3^-[1].

The human carbonic anhydrase IV (CA4) gene, located on chromosome 17q22, was the first identified membrane-bound isozyme in the 16-member carbonic anhydrase (CA) gene family and contains 1,170 base pairs. The CA4 enzyme is involved in the formation of gastric acid and participates in acid-base homeostasis. CA4 is expressed in normal human stomach tissues. CA4 may serve an important role in gastric cancer (GC) tumorigenesis by inhibiting cellular proliferation via regulating the expression of cell cycle‑associated proteins. CA4 may serve as a diagnostic biomarker and a potential therapeutic target in GC^[1].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-6*His

P22748 (A19-K283)

762  [NCBI]

AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKHHHHHH

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Bujiang Wang, et al. Carbonic anhydrase IV inhibits cell proliferation in gastric cancer by regulating the cell cycle. Oncol Lett. 2020 Oct;20(4):4.  [Content Brief]