Carbonic Anhydrase 4 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Carbonic Anhydrase 4 Protein, Human (His) a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3-.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Carbonic Anhydrase 4 Protein, Human (His) a recombinant Mouse Carbonic Anhydrase 4 produced in E. coli, has a His tag at the N-terminus. The Carbonic Anhydrase 4 (CA4) protein is a zinc metalloenzyme that catalyzes the reversible hydration and dehydration of CO2 and HCO3-[1].

Background

The human carbonic anhydrase IV (CA4) gene, located on chromosome 17q22, was the first identified membrane-bound isozyme in the 16-member carbonic anhydrase (CA) gene family and contains 1,170 base pairs. The CA4 enzyme is involved in the formation of gastric acid and participates in acid-base homeostasis. CA4 is expressed in normal human stomach tissues. CA4 may serve an important role in gastric cancer (GC) tumorigenesis by inhibiting cellular proliferation via regulating the expression of cell cycle‑associated proteins. CA4 may serve as a diagnostic biomarker and a potential therapeutic target in GC[1].

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CA4 (A19-K283)
      Accession # P22748-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Alpha-carbonic anhydrase Domain

  • Synonyms

    CA4; CAIV; Prev. RP17; CA-IV; Carbonic Anhydrase IV; Retinitis Pigmentosa 17 (Autosomal Dominant); Carbonate Dehydratase IV; Carbonic Dehydratase IV; Carbonic Anhydrase 4; Car4

  • AA Sequence

    AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIK

  • Predicted Molecular Mass

    31.4 kDa

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00