Cardiotrophin-1/CTF1 Protein, Human (HEK293, His)

Cardiotrophin-1/CTF1 protein induces cardiac myocyte hypertrophy in vitro by binding to and activating the ILST/gp130 receptor, highlighting its regulatory role in heart muscle cell enlargement. This engagement orchestrates signaling events that contribute to the hypertrophic response, providing insight into the mechanisms of cardiac hypertrophy and implicating Cardiotrophin-1 in heart muscle growth. Cardiotrophin-1/CTF1 Protein, Human (HEK293, His) is the recombinant human-derived Cardiotrophin-1/CTF1 protein, expressed by HEK293, with N-His labeled tag.

Cardiotrophin-1/CTF1 protein serves as a potent inducer of cardiac myocyte hypertrophy in vitro, underscoring its regulatory role in the enlargement of heart muscle cells. This effect is mediated through its binding to and activation of the ILST/gp130 receptor, indicating a specific molecular pathway through which Cardiotrophin-1 exerts its influence. By engaging with the ILST/gp130 receptor, Cardiotrophin-1 orchestrates signaling events that contribute to the hypertrophic response in cardiac myocytes. This molecular insight into the interaction between Cardiotrophin-1 and its receptor provides a foundational understanding of the mechanisms underlying cardiac hypertrophy and implicates this protein in the modulation of heart muscle growth.

Human

HEK293

N-His

Q16619-1 (S2-A201)

1489

Full Length

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

Approximately 27-30 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of 50 mM HAC, pH3.0 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.