CBS Protein, Human (His)

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag.

CBS, a hydro-lyase, plays a pivotal role in initiating the transsulfuration pathway by catalyzing the beta-replacement reaction where the hydroxyl group of L-serine is substituted by L-homocysteine, leading to the formation of L-cystathionine—a precursor to L-cysteine. This enzymatic process facilitates the elimination of L-methionine and the potentially harmful metabolite L-homocysteine. Beyond its role in catabolism, CBS is also integral to the production of hydrogen sulfide, serving as a gasotransmitter with both signaling and cytoprotective effects, particularly on neurons.

Immobilized Human CBS Protein at 2 μg/mL (100 μL/well) can bind CBS antibody.The ED₅₀ for this effect is 3.280 ng/mL.

• 
  Immobilized Human CBS Protein at 2 μg/mL (100 μL/well) can bind CBS antibody.The ED₅₀ for this effect is 3.280 ng/mL.

Human

E. coli

N-6*His

P35520 (P2-K551)

875  [NCBI]

Partial

PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Approximately 62 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.