CCN2/CTGF Protein, Human (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

CCN2/CTGF Protein, secreted by vascular endothelial cells, crucially promotes chondrocyte proliferation and differentiation, and mediates heparin- and divalent cation-dependent cell adhesion in diverse cell types. Additionally, it enhances fibroblast growth factor-induced DNA synthesis while existing as a monomer and interacting with TSKU. CCN2/CTGF Protein, Human (His) is the recombinant human-derived CCN2/CTGF protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CCN2/CTGF Protein, secreted by vascular endothelial cells, crucially promotes chondrocyte proliferation and differentiation, and mediates heparin- and divalent cation-dependent cell adhesion in diverse cell types. Additionally, it enhances fibroblast growth factor-induced DNA synthesis while existing as a monomer and interacting with TSKU. CCN2/CTGF Protein, Human (His) is the recombinant human-derived CCN2/CTGF protein, expressed by E. coli , with N-6*His labeled tag.

Background

CCN2/CTGF protein, a major connective tissue mitoattractant, is secreted by vascular endothelial cells. It plays a crucial role in promoting the proliferation and differentiation of chondrocytes. Additionally, CCN2/CTGF mediates heparin- and divalent cation-dependent cell adhesion in various cell types, including fibroblasts, myofibroblasts, endothelial cells, and epithelial cells. Furthermore, it enhances fibroblast growth factor-induced DNA synthesis. CCN2/CTGF exists as a monomer and interacts with TSKU.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/3T3 mouse cells. The ED50 for this effect is 1.264 μg/mL, corresponding to a specific activity is 791.1392 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CCN2 (G253-A349)
      Accession # P29279
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CCN2; CCN Family Member 2; Prev. CTGF; IBP-8; IGFBP8; SEMDLSL; Connective Tissue Growth Factor; IGFBP-8; Hypertrophic Chondrocyte-Specific Protein 24; NOV2; Insulin-Like Growth Factor-Binding Protein 8; KMD; IGF-Binding Protein 8; Cellular Communication N

  • AA Sequence

    GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00