CCN2/CTGF Protein, Human (His)
Based on 2 publication(s) in Google Scholar
CCN2/CTGF Protein, secreted by vascular endothelial cells, crucially promotes chondrocyte proliferation and differentiation, and mediates heparin- and divalent cation-dependent cell adhesion in diverse cell types. Additionally, it enhances fibroblast growth factor-induced DNA synthesis while existing as a monomer and interacting with TSKU. CCN2/CTGF Protein, Human (His) is the recombinant human-derived CCN2/CTGF protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CCN2/CTGF Protein, secreted by vascular endothelial cells, crucially promotes chondrocyte proliferation and differentiation, and mediates heparin- and divalent cation-dependent cell adhesion in diverse cell types. Additionally, it enhances fibroblast growth factor-induced DNA synthesis while existing as a monomer and interacting with TSKU. CCN2/CTGF Protein, Human (His) is the recombinant human-derived CCN2/CTGF protein, expressed by E. coli , with N-6*His labeled tag.
Background
CCN2/CTGF protein, a major connective tissue mitoattractant, is secreted by vascular endothelial cells. It plays a crucial role in promoting the proliferation and differentiation of chondrocytes. Additionally, CCN2/CTGF mediates heparin- and divalent cation-dependent cell adhesion in various cell types, including fibroblasts, myofibroblasts, endothelial cells, and epithelial cells. Furthermore, it enhances fibroblast growth factor-induced DNA synthesis. CCN2/CTGF exists as a monomer and interacts with TSKU.
Verified Bioactivity
Measured in a cell proliferation assay using Balb/3T3 mouse cells. The ED50 for this effect is 1.264 μg/mL, corresponding to a specific activity is 791.1392 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (2)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P29279 (G253-A349)
-
Molecular Construction
-
N-term
-
6*His
-
CCN2 (G253-A349)
Accession # P29279 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CCN2; CCN Family Member 2; Prev. CTGF; IBP-8; IGFBP8; SEMDLSL; Connective Tissue Growth Factor; IGFBP-8; Hypertrophic Chondrocyte-Specific Protein 24; NOV2; Insulin-Like Growth Factor-Binding Protein 8; KMD; IGF-Binding Protein 8; Cellular Communication N
-
AA Sequence
GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)