CD2 Protein, Canine (HEK293, His)
Based on 1 Customer Validation
CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, His) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, His) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD2 is a cell surface glycoprotein that plays a crucial role in mediating adhesion between T-cells and various cell types through interactions with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1. Beyond its adhesive function, CD2 is implicated in triggering T-cell responses, with its cytoplasmic domain playing a role in signaling pathways. The protein interacts with CD48, CD58 (LFA-3), CD2AP, and PSTPIP1, contributing to a complex network of molecular interactions. Additionally, the interaction between CD2 and FCGR3A modulates NK cell activation and cytotoxicity, highlighting its diverse involvement in immune cell functions[1][2][3].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-6*His
-
Accession
XP_849219.1 (E22-D204)
-
Molecular Construction
-
N-term
-
CD2 (E22-G204)
Accession # XP_849219.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD2; Rosette Receptor; Prev. SRBC; LFA-2; T-Cell Surface Antigen CD2; Lymphocyte-Function Antigen-2; CD2 Antigen (P50), Sheep Red Blood Cell Receptor; CD2 Antigen; T-Cell Surface Antigen T11/Leu-5; T11; Erythrocyte Receptor; CD2 Molecule; LFA-3 Receptor
-
AA Sequence
EVLETKLVWGALGHDFDLDSAGFQMNAKIDHIRWEKGKTKVAELKTGILKDTHGKYNISTNGFLKIKHLMMNDSDIYKVAIYDKDGKSVLRRNYQLKIQEKVSTPKILWSCGNQSLTCEITSGTDPTLMLYVNQTMIKNLLNMTIVQWNWTSQQEMTVSCTAKNEVSQKREEKIINCSEKGLD
-
Molecular Weight
Approximately 41 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
