1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD2
  5. CD2 Protein, Canine (HEK293, His)

CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, His) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, His) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD2 is a cell surface glycoprotein that plays a crucial role in mediating adhesion between T-cells and various cell types through interactions with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1. Beyond its adhesive function, CD2 is implicated in triggering T-cell responses, with its cytoplasmic domain playing a role in signaling pathways. The protein interacts with CD48, CD58 (LFA-3), CD2AP, and PSTPIP1, contributing to a complex network of molecular interactions. Additionally, the interaction between CD2 and FCGR3A modulates NK cell activation and cytotoxicity, highlighting its diverse involvement in immune cell functions[1][2][3].

Species

Canine

Source

HEK293

Tag

C-6*His

Accession

XP_849219.1 (E22-D204)

Gene ID
Molecular Construction
N-term
CD2 (E22-G204)
Accession # XP_849219.1
His
C-term
Protein Length

Partial

Synonyms
T-cell surface antigen CD2; LFA-2; CD2; SRBC
AA Sequence

EVLETKLVWGALGHDFDLDSAGFQMNAKIDHIRWEKGKTKVAELKTGILKDTHGKYNISTNGFLKIKHLMMNDSDIYKVAIYDKDGKSVLRRNYQLKIQEKVSTPKILWSCGNQSLTCEITSGTDPTLMLYVNQTMIKNLLNMTIVQWNWTSQQEMTVSCTAKNEVSQKREEKIINCSEKGLD

Molecular Weight

Approximately 41 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD2 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD2 Protein, Canine (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD2 Protein, Canine (HEK293, His)
Cat. No.:
HY-P74324
Quantity:
MCE Japan Authorized Agent: