1. Recombinant Proteins
  2. Immune Checkpoint Proteins Receptor Proteins
  3. Stimulatory Immune Checkpoint Molecules
  4. CD200R
  5. CD200R1
  6. CD200R1 Protein, Human (HEK293, His)

CD200R1 Protein, Human (HEK293, His)

Cat. No.: HY-P72749
Handling Instructions

The CD200R1 protein is an inhibitory receptor that regulates key interactions by binding to the CD200/OX2 glycoprotein to limit inflammation by inhibiting TNF-α, interferon, and iNOS. Interestingly, CD200R1 displays comparable affinity and kinetics to the human herpesvirus 8 K14 viral CD200 homologue, reflecting its host CD200 interaction. CD200R1 Protein, Human (HEK293, His) is the recombinant human-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD200R1 Protein, Human (HEK293, His) is 240 a.a., with molecular weight of 50-80 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD200R1 protein is an inhibitory receptor that regulates key interactions by binding to the CD200/OX2 glycoprotein to limit inflammation by inhibiting TNF-α, interferon, and iNOS. Interestingly, CD200R1 displays comparable affinity and kinetics to the human herpesvirus 8 K14 viral CD200 homologue, reflecting its host CD200 interaction. CD200R1 Protein, Human (HEK293, His) is the recombinant human-derived CD200R1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD200R1 Protein, Human (HEK293, His) is 240 a.a., with molecular weight of 50-80 kDa.

Background

CD200R1, an inhibitory receptor, acts as a pivotal modulator by binding to the CD200/OX2 cell surface glycoprotein. Its regulatory role extends to limiting inflammation through the suppression of pro-inflammatory molecules, including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS), in response to specific stimuli. Intriguingly, CD200R1 exhibits comparable affinity and kinetics when binding to the Human herpesvirus 8 K14 viral CD200 homolog, mirroring its interaction with the host CD200. The interaction between CD200 and CD200R1 is facilitated through their respective N-terminal Ig-like domains, emphasizing the significance of this molecular interplay. Moreover, CD200R1 engages with the Human herpesvirus 8 vOX2 protein, further expanding its versatile interactions in cellular processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8TD46 (A27-L266)

Gene ID
Molecular Construction
N-term
CD200R1 (A27-L266)
Accession # Q8TD46
6*His
C-term
Synonyms
Cell surface glycoprotein CD200 receptor 1; CD200R1; CD200R; CRTR2; MOX2R; OX2R
AA Sequence

AAQPNNSLMLQTSKENHALASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYRKETNETKETNCTDERITWVSRPDQNSDLQIRPVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAQISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKL

Molecular Weight

50-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CD200R1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD200R1 Protein, Human (HEK293, His)
Cat. No.:
HY-P72749
Quantity:
MCE Japan Authorized Agent: