CD200R1 Protein, Mouse (HEK293, His-Fc)

CD200R1 protein inhibits inflammatory responses by binding to CD200/OX2 cell surface glycoprotein and suppressing pro-inflammatory molecule expression. CD200R1 interacts with CD200 through their N-terminal Ig-like domains, providing a molecular mechanism for its role in regulating inflammation. CD200R1 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD200R1 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

CD200R1 protein functions as an inhibitory receptor for the CD200/OX2 cell surface glycoprotein, playing a pivotal role in regulating inflammatory responses. Its inhibitory action manifests by suppressing the expression of pro-inflammatory molecules such as TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to specific stimuli. The interaction between CD200 and CD200R1 is mediated through their respective N-terminal Ig-like domains, highlighting a key molecular mechanism through which this receptor contributes to the modulation of inflammatory processes.

Mouse

HEK293

C-hFc;C-His

Q9ES57/NP_067300.1 (T26-P238)

57781  [NCBI]

Extracellular Domain

TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP

Approximately 90-100 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.