CD23/Fc epsilon RII Protein, Human (Biotinylated, HEK293, His, Avi)

CD23 or Fc epsilon receptor II (Fc epsilon RII) is a low-affinity receptor for immunoglobulin E (IgE) and complements receptor 2 (CR2/CD21). CD23 is present on B cells, regulates IgE production and B cell differentiation, and aids in IgE-dependent antigen uptake. CD23/Fc epsilon RII Protein, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived CD23/Fc epsilon RII protein, expressed by HEK293, with N-Avi and N-His labeled tag.

CD23, also known as Fc epsilon receptor II (Fc epsilon RII), functions as a low-affinity receptor for immunoglobulin E (IgE) and complements receptor 2 (CR2/CD21). Playing crucial roles in the regulation of IgE production and B cell differentiation, CD23 on B cells facilitates IgE-dependent antigen uptake and presentation to T cells. In macrophages, IgE binding and antigen cross-linking trigger intracellular killing of parasites by activating the L-Arginine-nitric oxide pathway. CD23 forms homotrimers and interacts with IGHE, specifically via its C-type lectin domain, regulating IgE homeostasis. Furthermore, CD23 interacts with CR2/CD21 through its C-terminus, specifically engaging with Sushi domains 1 and 2 of CR2/CD21. These interactions underscore CD23's multifaceted involvement in immune responses, ranging from B cell activation to the macrophage-mediated defense against parasites.

Human

HEK293

N-Avi;N-8*His

P06734 (D48-S321)

2208

Extracellular Domain

Biotin

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Approximately 42-52 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.