CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, His)
Based on 1 publication(s) in Google Scholar
The CD28 protein is critical for T cell activation, enhancing proliferation, cytokine production, and survival. When linked to TCR/CD3 and CD40L, CD28 promotes the production of IL4 and IL10, thereby regulating immune responses. CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant human-derived CD28 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Rhesus Macaque; Human; Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD28 protein is critical for T cell activation, enhancing proliferation, cytokine production, and survival. When linked to TCR/CD3 and CD40L, CD28 promotes the production of IL4 and IL10, thereby regulating immune responses. CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant human-derived CD28 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
CD28 protein plays a pivotal role in T-cell activation, promoting cell proliferation, cytokine production, and T-cell survival. Upon ligation with TCR/CD3 and CD40L costimulation, CD28 enhances the production of IL4 and IL10 in T-cells, contributing to immune response modulation. Additionally, isoform 3 of CD28 facilitates CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. The protein forms homodimers through disulfide linkages and interacts with various molecules, including DUSP14, CD80/B7-1, CD86/B7-2/B70, and GRB2. Isoform 3 specifically interacts with CD40LG, highlighting its multifaceted role in mediating immune responses and cellular signaling pathways.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD28 at 1 μg/mL(100 μL/Well) can bind Biotinylated Human B7-1 (HY-P78382). The ED50 for this effect is 2.261 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Rhesus Macaque; Human; Cynomolgus
-
Source HEK293
-
Tag N-6*His
-
Accession
P10747-1/Q0PDN3/Q0PDN4 (N19-P152)
-
Molecular Construction
-
N-term
-
6*His
-
CD28 (N19-P152)
Accession # P10747-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD28; CD28 Antigen; CD28 Molecule; IMD123; T-Cell-Specific Surface Glycoprotein CD28; Tp44; T-Cell-Specific Surface Glycoprotein; TP44; CD28 Antigen (Tp44)
-
AA Sequence
NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
