CD30/TNFRSF8 Protein, Human (HEK293, His)

CD30/TNFRSF8, a receptor for TNFSF8/CD30L, regulates cellular growth and lymphoblast transformation. It activates NF-kappa-B, modulating gene expression. Interactions with TRAF1, TRAF2, TRAF3, and TRAF5 indicate involvement in complex signaling networks. Engagement with TNFSF8 implies impact on immune responses and cellular homeostasis, emphasizing its significance in fundamental biological processes. CD30/TNFRSF8 Protein, Human (HEK293, His) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD30/TNFRSF8 Protein, Human (HEK293, His) is 361 a.a., with molecular weight of 60-95 kDa.

CD30/TNFRSF8, a receptor for TNFSF8/CD30L, is implicated in the regulation of cellular growth and the transformation of activated lymphoblasts. This receptor plays a role in modulating gene expression by activating NF-kappa-B, a key transcription factor associated with diverse cellular processes. The interaction of CD30/TNFRSF8 with signaling adapters such as TRAF1, TRAF2, TRAF3, and TRAF5 underscores its involvement in intricate cellular signaling networks. This receptor's engagement with TNFSF8 suggests its potential impact on immune responses and cellular homeostasis, highlighting its significance in the regulation of fundamental biological processes.

Human

HEK293

C-6*His

P28908 (F19-K379)

943  [NCBI]

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

60-95 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.