CD40 Protein, Canine (P.pastoris, His)

CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (P.pastoris, His) is the recombinant canine-derived CD40 protein, expressed by P. pastoris , with C-His labeled tag.

CD40 Protein acts as the receptor for TNFSF5/CD40LG, transducing signals mediated by TRAF6 and MAP3K8 to activate ERK in macrophages and B cells, ultimately inducing immunoglobulin secretion. Existing as both a monomer and homodimer, CD40 Protein interacts with various TRAF proteins, including TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6. Furthermore, its interaction with TRAF6 and MAP3K8 is essential for the activation of ERK.

Canine

P. pastoris

C-His

Q7YRL5 (E21-A194)

403469  [NCBI]

Extracellular Domain

EPRTACREKQYLVDSQCCNMCPPGEKLVNDCLHTIDTECTRCQTGEFLDTWNAERHCHQHKYCDPNLGLHVEKEGTSETDTTCTCDEGLHCTNAACESCTMHSLCPPGLGVKQIATGISDTICDPCPIGFFSNVSSALEKCHPWTSCETKGLVKVQAGTNKTDVICGPQPRLRA

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.