CD40 Protein, Mouse (174a.a, HEK293, His)

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through the TRAF6 and MAP3K8 pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists in monomeric and homodimeric forms, interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6) and crucially mediates cellular responses to external signals. CD40 Protein, Mouse (174a.a, HEK293, His) is the recombinant mouse-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD40 Protein, Mouse (174a.a, HEK293, His) is 174 a.a., with molecular weight of 21-25 kDa.

CD40 Protein serves as the receptor for TNFSF5/CD40LG, transducing signals through TRAF6 and MAP3K8 pathways to activate ERK in macrophages and B cells, resulting in the induction of immunoglobulin secretion. Existing in both monomeric and homodimeric forms, CD40 Protein interacts with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, playing a crucial role in mediating cellular responses to external signals. The interaction with TRAF6 and MAP3K8 is particularly essential for the activation of ERK and subsequent cellular processes.

Mouse

HEK293

C-6*His

P27512 (L20-R193)

21939  [NCBI]

LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMR

21-25 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.