CD40 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through the TRAF6 and MAP3K8 pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists in monomeric and homodimeric forms, interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6) and crucially mediates cellular responses to external signals. CD40 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through the TRAF6 and MAP3K8 pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists in monomeric and homodimeric forms, interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6) and crucially mediates cellular responses to external signals. CD40 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CD40 Protein serves as the receptor for TNFSF5/CD40LG, transducing signals through TRAF6 and MAP3K8 pathways to activate ERK in macrophages and B cells, resulting in the induction of immunoglobulin secretion. Existing in both monomeric and homodimeric forms, CD40 Protein interacts with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, playing a crucial role in mediating cellular responses to external signals. The interaction with TRAF6 and MAP3K8 is particularly essential for the activation of ERK and subsequent cellular processes.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well), can bind Recombinant Mouse CD40 Ligand/TNFSF5. The ED50 for this effect is 309.5 ng/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P27512-1 (L20-R193)
-
Molecular Construction
-
N-term
-
CD40 (L20-R193)
Accession # P27512-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMR
-
Predicted Molecular Mass
20.2 kDa
-
Molecular Weight
Approximately 22-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)