CD47 Protein, Mouse (140a.a, HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD47 protein is an adhesive multifunctional protein that coordinates cell-cell interactions, serves as a THBS1 receptor, and regulates integrin signaling through heterotrimeric G proteins.It plays a key role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, immune regulation, and memory formation. CD47 Protein, Mouse (140a.a, HEK293, His) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD47 protein is an adhesive multifunctional protein that coordinates cell-cell interactions, serves as a THBS1 receptor, and regulates integrin signaling through heterotrimeric G proteins.It plays a key role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cell self-renewal, immune regulation, and memory formation. CD47 Protein, Mouse (140a.a, HEK293, His) is the recombinant mouse-derived CD47 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD47 Protein, an adhesive protein, orchestrates cell-to-cell interactions and acts as a receptor for thrombospondin THBS1, concurrently modulating integrin signaling through the activation of heterotrimeric G proteins. This multifaceted protein is intricately involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. CD47 plays a pivotal role in modulating pulmonary endothelin EDN1 signaling and acts as a pressor agent supporting blood pressure in response to THBS1-induced nitrous oxide (NO) signaling. Additionally, it contributes significantly to memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, CD47 prevents the maturation of immature dendritic cells, inhibits cytokine production by mature dendritic cells, and mediates cell-cell adhesion through interaction with SIRPG. Furthermore, it positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, potentially influencing metabolic dysregulation during normal aging. CD47's role in wound healing modulation, inhibition of stem cell self-renewal, potential involvement in membrane transport, integrin-dependent signal transduction, and prevention of premature elimination of red blood cells underscores its diverse impact on cellular processes. Existing as a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and possibly fibrinogen, emphasizing its intricate involvement in a wide array of cellular pathways.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD47 (Q19-P158)
      Accession # Q61735-2
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD47; Antigen Identified By Monoclonal Antibody 1D8; Prev. MER6; Integrin-Associated Protein; Leukocyte Surface Antigen CD47; Rh-Related Antigen; IAP; CD47 Glycoprotein; Antigenic Surface Determinant Protein OA3; Integrin-Associated Signal Transducer; OA3

  • AA Sequence

    QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP

  • Predicted Molecular Mass

    16.7 kDa

  • Molecular Weight

    Approximately 30-60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00