1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. CD47 Protein, Mouse (HEK293, His)

CD47 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70820
COA Handling Instructions

CD47 Protein, an adhesive multifunctional protein, orchestrates cell-to-cell interactions, serving as a receptor for THBS1 and modulating integrin signaling via heterotrimeric G proteins. It plays a pivotal role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, immunoregulation, and memory formation. CD47, a receptor for SIRPA, influences dendritic cell maturation, inhibits cytokine production, and mediates cell-cell adhesion. Additionally, it modulates pulmonary EDN1 signaling, supports blood pressure in response to THBS1-induced NO signaling, and contributes to memory formation. CD47's role in wound healing, stem cell self-renewal inhibition, and its interactions with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and possibly fibrinogen underscore its diverse impact on cellular processes. Existing as a monomer, CD47 exhibits intricate involvement in various cellular pathways. CD47 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD47 protein, expressed by HEK293, with C-6*His labeled tag. The total length of CD47 Protein, Mouse (HEK293, His) is 140 a.a., with molecular weight of 30-60 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD47 Protein, an adhesive multifunctional protein, orchestrates cell-to-cell interactions, serving as a receptor for THBS1 and modulating integrin signaling via heterotrimeric G proteins. It plays a pivotal role in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, immunoregulation, and memory formation. CD47, a receptor for SIRPA, influences dendritic cell maturation, inhibits cytokine production, and mediates cell-cell adhesion. Additionally, it modulates pulmonary EDN1 signaling, supports blood pressure in response to THBS1-induced NO signaling, and contributes to memory formation. CD47's role in wound healing, stem cell self-renewal inhibition, and its interactions with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and possibly fibrinogen underscore its diverse impact on cellular processes. Existing as a monomer, CD47 exhibits intricate involvement in various cellular pathways. CD47 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD47 protein, expressed by HEK293, with C-6*His labeled tag. The total length of CD47 Protein, Mouse (HEK293, His) is 140 a.a., with molecular weight of 30-60 kDa.

Background

CD47 Protein, an adhesive protein, orchestrates cell-to-cell interactions and acts as a receptor for thrombospondin THBS1, concurrently modulating integrin signaling through the activation of heterotrimeric G proteins. This multifaceted protein is intricately involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. CD47 plays a pivotal role in modulating pulmonary endothelin EDN1 signaling and acts as a pressor agent supporting blood pressure in response to THBS1-induced nitrous oxide (NO) signaling. Additionally, it contributes significantly to memory formation and synaptic plasticity in the hippocampus. As a receptor for SIRPA, CD47 prevents the maturation of immature dendritic cells, inhibits cytokine production by mature dendritic cells, and mediates cell-cell adhesion through interaction with SIRPG. Furthermore, it positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, potentially influencing metabolic dysregulation during normal aging. CD47's role in wound healing modulation, inhibition of stem cell self-renewal, potential involvement in membrane transport, integrin-dependent signal transduction, and prevention of premature elimination of red blood cells underscores its diverse impact on cellular processes. Existing as a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and possibly fibrinogen, emphasizing its intricate involvement in a wide array of cellular pathways.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q61735-2 (Q19-P158)

Gene ID

16423  [NCBI]

Molecular Construction
N-term
CD47 (Q19-P158)
Accession # Q61735-2
6*His
C-term
Synonyms
Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
AA Sequence

QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSP

Molecular Weight

30-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD47 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70820
Quantity:
MCE Japan Authorized Agent: