CD5 Protein, Mouse (347a.a, HEK293, His)

CD5 protein, acting as a receptor, crucially regulates T-cell proliferation by engaging in vital interactions with CD72/LYB-2. Additionally, its potential interactions with PTPN6/SHP-1 highlight its integral role in essential signaling pathways. CD5 Protein, Mouse (347a.a, HEK293, His) is the recombinant mouse-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD5 Protein, Mouse (347a.a, HEK293, His) is 347 a.a., with molecular weight of 42-58 kDa.

CD5 protein functions as a receptor that plays a pivotal role in the regulation of T-cell proliferation. It is involved in crucial interactions with CD72/LYB-2 and also exhibits potential interactions with PTPN6/SHP-1, indicating its involvement in important signaling pathways.

Mouse

HEK293

C-6*His

P13379 (Q24-N370)

12507  [NCBI]

QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPN

42-58 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.