CD5 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD5 protein, acting as a receptor, crucially regulates T-cell proliferation by engaging in vital interactions with CD72/LYB-2. Additionally, its potential interactions with PTPN6/SHP-1 highlight its integral role in essential signaling pathways. CD5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD5 protein, acting as a receptor, crucially regulates T-cell proliferation by engaging in vital interactions with CD72/LYB-2. Additionally, its potential interactions with PTPN6/SHP-1 highlight its integral role in essential signaling pathways. CD5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CD5 protein functions as a receptor that plays a pivotal role in the regulation of T-cell proliferation. It is involved in crucial interactions with CD72/LYB-2 and also exhibits potential interactions with PTPN6/SHP-1, indicating its involvement in important signaling pathways.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P13379 (Q24-N370)
-
Molecular Construction
-
N-term
-
CD5 (Q24-N370)
Accession # P13379 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD5; Lymphocyte Antigen T1/Leu-1; Prev. LEU1; Epididymis Secretory Sperm Binding Protein; T-Cell Surface Glycoprotein CD5; CD5 Antigen; T1; CD5 Molecule; CD5 Antigen (P56-62)
-
AA Sequence
QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPN
-
Predicted Molecular Mass
38.9 kDa
-
Molecular Weight
Approximately 42-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)